BLASTX nr result
ID: Rheum21_contig00020018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00020018 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280704.1| PREDICTED: chloroplastic group IIA intron sp... 59 7e-07 >ref|XP_002280704.1| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like [Vitis vinifera] Length = 1184 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/65 (50%), Positives = 36/65 (55%) Frame = +3 Query: 276 GEEPKIKMPTAPWMTGPLLLPPGEVLHLSXXXXXXXXXXXHGSSRDPDRFLTQKVPGRMG 455 G + IKMPTAPWM GPLLL P EVL LS + PDR LT+KV G G Sbjct: 68 GTDAAIKMPTAPWMKGPLLLQPNEVLDLS--KARPKKVAGSAGAEKPDRSLTEKVSGGRG 125 Query: 456 KKASK 470 KA K Sbjct: 126 AKAMK 130