BLASTX nr result
ID: Rheum21_contig00018584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00018584 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW16512.1| hypothetical protein PHAVU_007G162600g [Phaseolus... 55 1e-05 >gb|ESW16512.1| hypothetical protein PHAVU_007G162600g [Phaseolus vulgaris] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/67 (50%), Positives = 39/67 (58%), Gaps = 5/67 (7%) Frame = +1 Query: 205 YTSQSPLPPPH-----HRSGELSALLDRSKRNIHGLFLGYSGVGNGIYASRFSPLLDVPH 369 ++S PPH R G S +L SKR + +FLG GVG G YASR S LLDVPH Sbjct: 24 FSSSQVNAPPHAAAASFRRGPRSDIL--SKRCVQWVFLGCPGVGKGTYASRLSNLLDVPH 81 Query: 370 IAIGDPV 390 IA GD V Sbjct: 82 IATGDLV 88