BLASTX nr result
ID: Rheum21_contig00018038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00018038 (544 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444278.1| hypothetical protein CICLE_v10023157mg [Citr... 55 8e-06 >ref|XP_006444278.1| hypothetical protein CICLE_v10023157mg [Citrus clementina] gi|557546540|gb|ESR57518.1| hypothetical protein CICLE_v10023157mg [Citrus clementina] Length = 77 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 1/81 (1%) Frame = +3 Query: 24 MKPPHLAGDAPFIHDELKRGLGDKLRRVYKTSLVSMDTRSNNKGNRGPRVSTSGGSIWRV 203 MK +AG++ HD KR +G+K R+ Y+ ++V+ + + RG V + G R Sbjct: 1 MKHHQVAGESSLTHDS-KRTIGEKFRQAYEAAMVAA---AGDGVQRGCNVPINRGIERRK 56 Query: 204 DN-RREDPIRTILFLGSWNHT 263 + R EDPIRTI+FLGSW+HT Sbjct: 57 PSYRAEDPIRTIMFLGSWSHT 77