BLASTX nr result
ID: Rheum21_contig00017971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00017971 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW19403.1| hypothetical protein PHAVU_006G122000g [Phaseolus... 65 1e-08 gb|EEC67208.1| hypothetical protein OsI_34094 [Oryza sativa Indi... 62 6e-08 ref|XP_006359304.1| PREDICTED: thioredoxin-like protein 4A-like ... 62 1e-07 gb|ESW25064.1| hypothetical protein PHAVU_003G004100g [Phaseolus... 62 1e-07 ref|XP_004973430.1| PREDICTED: thioredoxin-like protein 4A-like ... 62 1e-07 gb|EMT25324.1| Thioredoxin-like protein 4A [Aegilops tauschii] 62 1e-07 gb|EMJ22410.1| hypothetical protein PRUPE_ppa013055mg [Prunus pe... 62 1e-07 ref|XP_004231501.1| PREDICTED: thioredoxin-like protein 4A-like ... 62 1e-07 ref|NP_001064903.1| Os10g0486600 [Oryza sativa Japonica Group] g... 62 1e-07 dbj|BAJ88120.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 1e-07 dbj|BAJ90457.1| predicted protein [Hordeum vulgare subsp. vulgar... 62 1e-07 gb|EXC33990.1| Thioredoxin-like protein 4A [Morus notabilis] 61 1e-07 ref|XP_006437597.1| hypothetical protein CICLE_v10033145mg [Citr... 61 1e-07 ref|XP_004293898.1| PREDICTED: thioredoxin-like protein 4A-like ... 61 1e-07 ref|XP_004163626.1| PREDICTED: thioredoxin-like protein 4A-like ... 61 1e-07 ref|XP_004148041.1| PREDICTED: thioredoxin-like protein 4A-like ... 61 1e-07 ref|XP_002871315.1| hypothetical protein ARALYDRAFT_908777 [Arab... 61 1e-07 gb|ACJ85953.1| unknown [Medicago truncatula] gi|388522237|gb|AFK... 61 1e-07 ref|XP_003590204.1| Thioredoxin-like 4A [Medicago truncatula] gi... 61 1e-07 ref|XP_002310072.1| hypothetical protein POPTR_0007s07660g [Popu... 61 1e-07 >gb|ESW19403.1| hypothetical protein PHAVU_006G122000g [Phaseolus vulgaris] Length = 180 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 418 RKRDMSYLLPHLHSGWAVDQAILAEEERLVIIR 516 +K+ MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 35 KKKKMSYLLPHLHSGWAVDQAILAEEERLVIIR 67 >gb|EEC67208.1| hypothetical protein OsI_34094 [Oryza sativa Indica Group] Length = 274 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +1 Query: 427 DMSYLLPHLHSGWAVDQAILAEEERLVIIR 516 +MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 132 EMSYLLPHLHSGWAVDQAILAEEERLVIIR 161 >ref|XP_006359304.1| PREDICTED: thioredoxin-like protein 4A-like [Solanum tuberosum] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >gb|ESW25064.1| hypothetical protein PHAVU_003G004100g [Phaseolus vulgaris] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >ref|XP_004973430.1| PREDICTED: thioredoxin-like protein 4A-like isoform X1 [Setaria italica] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >gb|EMT25324.1| Thioredoxin-like protein 4A [Aegilops tauschii] Length = 163 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >gb|EMJ22410.1| hypothetical protein PRUPE_ppa013055mg [Prunus persica] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >ref|XP_004231501.1| PREDICTED: thioredoxin-like protein 4A-like [Solanum lycopersicum] gi|565367404|ref|XP_006350358.1| PREDICTED: thioredoxin-like protein 4A-like [Solanum tuberosum] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >ref|NP_001064903.1| Os10g0486600 [Oryza sativa Japonica Group] gi|226498606|ref|NP_001148867.1| LOC100282486 [Zea mays] gi|297725467|ref|NP_001175097.1| Os07g0202450 [Oryza sativa Japonica Group] gi|242079123|ref|XP_002444330.1| hypothetical protein SORBIDRAFT_07g020280 [Sorghum bicolor] gi|242092472|ref|XP_002436726.1| hypothetical protein SORBIDRAFT_10g007680 [Sorghum bicolor] gi|514816077|ref|XP_004982785.1| PREDICTED: thioredoxin-like protein 4A-like [Setaria italica] gi|573950496|ref|XP_006657540.1| PREDICTED: thioredoxin-like protein YLS8-like [Oryza brachyantha] gi|18087886|gb|AAL59040.1|AC087182_23 putative thioredoxin-like U5 small ribonucleoprotein particle protein [Oryza sativa Japonica Group] gi|31432762|gb|AAP54355.1| Thioredoxin-like protein 4A, putative, expressed [Oryza sativa Japonica Group] gi|33146577|dbj|BAC79773.1| putative dim1p [Oryza sativa Japonica Group] gi|50508616|dbj|BAD31005.1| putative dim1p [Oryza sativa Japonica Group] gi|113639512|dbj|BAF26817.1| Os10g0486600 [Oryza sativa Japonica Group] gi|195620258|gb|ACG31959.1| mitosis protein dim1 [Zea mays] gi|195622740|gb|ACG33200.1| mitosis protein dim1 [Zea mays] gi|215686611|dbj|BAG88864.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768559|dbj|BAH00788.1| unnamed protein product [Oryza sativa Japonica Group] gi|218199272|gb|EEC81699.1| hypothetical protein OsI_25296 [Oryza sativa Indica Group] gi|222613039|gb|EEE51171.1| hypothetical protein OsJ_31953 [Oryza sativa Japonica Group] gi|222636632|gb|EEE66764.1| hypothetical protein OsJ_23479 [Oryza sativa Japonica Group] gi|241914949|gb|EER88093.1| hypothetical protein SORBIDRAFT_10g007680 [Sorghum bicolor] gi|241940680|gb|EES13825.1| hypothetical protein SORBIDRAFT_07g020280 [Sorghum bicolor] gi|255677591|dbj|BAH93825.1| Os07g0202450 [Oryza sativa Japonica Group] gi|414870567|tpg|DAA49124.1| TPA: mitosis protein dim1 [Zea mays] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >dbj|BAJ88120.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >dbj|BAJ90457.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326534264|dbj|BAJ89482.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLVIIR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVIIR 29 >gb|EXC33990.1| Thioredoxin-like protein 4A [Morus notabilis] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >ref|XP_006437597.1| hypothetical protein CICLE_v10033145mg [Citrus clementina] gi|568862096|ref|XP_006484526.1| PREDICTED: thioredoxin-like protein YLS8-like isoform X1 [Citrus sinensis] gi|557539793|gb|ESR50837.1| hypothetical protein CICLE_v10033145mg [Citrus clementina] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >ref|XP_004293898.1| PREDICTED: thioredoxin-like protein 4A-like [Fragaria vesca subsp. vesca] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >ref|XP_004163626.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >ref|XP_004148041.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus] gi|502122515|ref|XP_004497782.1| PREDICTED: thioredoxin-like protein 4A-like [Cicer arietinum] gi|565461720|ref|XP_006288859.1| hypothetical protein CARUB_v10002214mg [Capsella rubella] gi|567171688|ref|XP_006399318.1| hypothetical protein EUTSA_v10014963mg [Eutrema salsugineum] gi|317159581|gb|ADV04065.1| mitosis protein YLS8 [Hevea brasiliensis] gi|465111413|gb|AGH25793.1| YLS8 [Gossypium hirsutum] gi|482557565|gb|EOA21757.1| hypothetical protein CARUB_v10002214mg [Capsella rubella] gi|557100408|gb|ESQ40771.1| hypothetical protein EUTSA_v10014963mg [Eutrema salsugineum] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >ref|XP_002871315.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. lyrata] gi|297317152|gb|EFH47574.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. lyrata] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >gb|ACJ85953.1| unknown [Medicago truncatula] gi|388522237|gb|AFK49180.1| unknown [Medicago truncatula] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >ref|XP_003590204.1| Thioredoxin-like 4A [Medicago truncatula] gi|116782603|gb|ABK22569.1| unknown [Picea sitchensis] gi|116782987|gb|ABK22751.1| unknown [Picea sitchensis] gi|355479252|gb|AES60455.1| Thioredoxin-like 4A [Medicago truncatula] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29 >ref|XP_002310072.1| hypothetical protein POPTR_0007s07660g [Populus trichocarpa] gi|225432821|ref|XP_002283622.1| PREDICTED: thioredoxin-like protein 4A [Vitis vinifera] gi|255577696|ref|XP_002529724.1| mitosis protein dim1, putative [Ricinus communis] gi|356532239|ref|XP_003534681.1| PREDICTED: DIM protein [Glycine max] gi|356571707|ref|XP_003554015.1| PREDICTED: thioredoxin-like protein YLS8-like [Glycine max] gi|586716637|ref|XP_006847846.1| hypothetical protein AMTR_s00029p00063040 [Amborella trichopoda] gi|118484553|gb|ABK94150.1| unknown [Populus trichocarpa] gi|222852975|gb|EEE90522.1| hypothetical protein POPTR_0007s07660g [Populus trichocarpa] gi|223530788|gb|EEF32653.1| mitosis protein dim1, putative [Ricinus communis] gi|255629203|gb|ACU14946.1| unknown [Glycine max] gi|297737123|emb|CBI26324.3| unnamed protein product [Vitis vinifera] gi|508707211|gb|EOX99107.1| MRNA splicing factor, thioredoxin-like U5 snRNP isoform 2 [Theobroma cacao] gi|548851151|gb|ERN09427.1| hypothetical protein AMTR_s00029p00063040 [Amborella trichopoda] Length = 142 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 430 MSYLLPHLHSGWAVDQAILAEEERLVIIR 516 MSYLLPHLHSGWAVDQAILAEEERLV+IR Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIR 29