BLASTX nr result
ID: Rheum21_contig00017815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00017815 (221 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38786.2| Gag-pol polyprotein, putative [Solanum demissum] 56 6e-06 >gb|AAT38786.2| Gag-pol polyprotein, putative [Solanum demissum] Length = 1140 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/48 (45%), Positives = 32/48 (66%) Frame = -3 Query: 213 CKHCKKFGHKEDNCWHKGKPQCFKCKRFGHVQRNCRFDNENEPSMAQV 70 C +CKK H + CW++ QC CK+FGHV + C+ N+N+P+ AQV Sbjct: 258 CPYCKKTNHTDKFCWYRPGVQCKLCKQFGHVDKVCKI-NQNQPAQAQV 304