BLASTX nr result
ID: Rheum21_contig00017705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00017705 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006396488.1| hypothetical protein EUTSA_v10029065mg [Eutr... 58 1e-06 >ref|XP_006396488.1| hypothetical protein EUTSA_v10029065mg [Eutrema salsugineum] gi|557097505|gb|ESQ37941.1| hypothetical protein EUTSA_v10029065mg [Eutrema salsugineum] Length = 128 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 102 SDGGSARSAGEESTEEAMKVTRRIMFVKPPGYQG 1 SDGGS RS GE+S EEA+KVTR IM VKPPGYQG Sbjct: 41 SDGGSVRSYGEDSPEEAVKVTRSIMIVKPPGYQG 74