BLASTX nr result
ID: Rheum21_contig00017460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00017460 (980 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004290273.1| PREDICTED: uncharacterized protein LOC101314... 59 3e-06 gb|EMJ01788.1| hypothetical protein PRUPE_ppa012025mg [Prunus pe... 59 4e-06 >ref|XP_004290273.1| PREDICTED: uncharacterized protein LOC101314142 isoform 2 [Fragaria vesca subsp. vesca] Length = 178 Score = 58.9 bits (141), Expect = 3e-06 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 8/85 (9%) Frame = +2 Query: 431 RLCILRSPR---GQRRGRC*LTSSEATCG-----LALGEEFVVAERINKSLSNILKQLNK 586 R C+L S R G RR L SS G E+F V+ I++ LS ILKQ+NK Sbjct: 6 RSCLLGSLRVAAGWRRSYVKLASSSYAQGGREIEADEDEDFPVSSGISRPLSEILKQINK 65 Query: 587 RVPDSLVKDLSEEGLAMKYVPWNLL 661 +VPD+LVK E G KY+PW+++ Sbjct: 66 KVPDTLVKSRHENGFTSKYIPWHIV 90 >gb|EMJ01788.1| hypothetical protein PRUPE_ppa012025mg [Prunus persica] Length = 187 Score = 58.5 bits (140), Expect = 4e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 527 FVVAERINKSLSNILKQLNKRVPDSLVKDLSEEGLAMKYVPWNLL 661 F V+ I++ LS ILKQLNK+VPDSLVK SE G KY+PW+++ Sbjct: 55 FAVSSGISRPLSEILKQLNKKVPDSLVKTRSESGFTSKYIPWHIV 99