BLASTX nr result
ID: Rheum21_contig00017378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00017378 (653 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159605.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_004149630.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_003635394.1| PREDICTED: putative pentatricopeptide repeat... 111 2e-22 ref|XP_002530608.1| pentatricopeptide repeat-containing protein,... 110 4e-22 ref|XP_003546958.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|NP_201383.1| pentatricopeptide repeat-containing protein [Ar... 108 2e-21 emb|CAA16678.1| predicted protein [Arabidopsis thaliana] 108 2e-21 ref|XP_002866691.1| pentatricopeptide repeat-containing protein ... 107 2e-21 ref|XP_006595472.1| PREDICTED: putative pentatricopeptide repeat... 106 5e-21 gb|EXC12605.1| hypothetical protein L484_012982 [Morus notabilis] 103 3e-20 gb|EOX91773.1| Pentatricopeptide repeat (PPR) superfamily protei... 103 3e-20 ref|XP_006393982.1| hypothetical protein EUTSA_v10003830mg [Eutr... 103 6e-20 ref|XP_006348483.1| PREDICTED: pentatricopeptide repeat-containi... 99 8e-19 ref|XP_004513407.1| PREDICTED: putative pentatricopeptide repeat... 98 2e-18 ref|XP_006281497.1| hypothetical protein CARUB_v10027590mg [Caps... 98 2e-18 ref|XP_006466418.1| PREDICTED: putative pentatricopeptide repeat... 95 2e-17 ref|XP_002877696.1| pentatricopeptide repeat-containing protein ... 95 2e-17 ref|XP_006426145.1| hypothetical protein CICLE_v10025134mg [Citr... 94 3e-17 gb|EPS62602.1| hypothetical protein M569_12187, partial [Genlise... 92 2e-16 ref|NP_190542.4| pentatricopeptide repeat-containing protein [Ar... 91 2e-16 >ref|XP_004159605.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like [Cucumis sativus] Length = 664 Score = 115 bits (287), Expect = 1e-23 Identities = 52/81 (64%), Positives = 67/81 (82%) Frame = -1 Query: 245 SNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGIVM 66 + + G G ++L + PH ++DR+ DEF+ DVEK+YRILRKFH+RVPKLELALQESG++M Sbjct: 70 TQRGGFGPIHLKTTPHES-AHDRDADEFSVDVEKVYRILRKFHTRVPKLELALQESGVIM 128 Query: 65 RAGMAERVLGRCGDAGNLAYR 3 R+G+ ERVL RCGDAGNL YR Sbjct: 129 RSGLPERVLSRCGDAGNLGYR 149 >ref|XP_004149630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like [Cucumis sativus] Length = 641 Score = 115 bits (287), Expect = 1e-23 Identities = 52/81 (64%), Positives = 67/81 (82%) Frame = -1 Query: 245 SNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGIVM 66 + + G G ++L + PH ++DR+ DEF+ DVEK+YRILRKFH+RVPKLELALQESG++M Sbjct: 47 TQRGGFGPIHLKTTPHES-AHDRDADEFSVDVEKVYRILRKFHTRVPKLELALQESGVIM 105 Query: 65 RAGMAERVLGRCGDAGNLAYR 3 R+G+ ERVL RCGDAGNL YR Sbjct: 106 RSGLPERVLSRCGDAGNLGYR 126 >ref|XP_003635394.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like [Vitis vinifera] Length = 622 Score = 111 bits (277), Expect = 2e-22 Identities = 55/79 (69%), Positives = 64/79 (81%) Frame = -1 Query: 239 QNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGIVMRA 60 + G GLV L S N +YD+ DEF+ADVEK+YRILRKFHSRVPKLELALQESG+ +R+ Sbjct: 30 RGGFGLVRLESNRENC-TYDQNYDEFSADVEKVYRILRKFHSRVPKLELALQESGVAVRS 88 Query: 59 GMAERVLGRCGDAGNLAYR 3 G+ ERVL RCGDAGNL YR Sbjct: 89 GLTERVLNRCGDAGNLGYR 107 >ref|XP_002530608.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529856|gb|EEF31788.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 596 Score = 110 bits (275), Expect = 4e-22 Identities = 59/101 (58%), Positives = 70/101 (69%), Gaps = 3/101 (2%) Frame = -1 Query: 296 YEPSISPRDHSHSDASYSNQNGIGLVYLNSMPHNGHSYDR---EVDEFAADVEKIYRILR 126 Y+ P D + S + +NG G+V L + +N D +VDEFA DVEK+YRILR Sbjct: 27 YQKGQEPIDRN--PLSNNLRNGFGVVCLKTQENNTSDRDNSSSKVDEFAKDVEKVYRILR 84 Query: 125 KFHSRVPKLELALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 FHSRVPKLELALQESG+ MRAG+ ERVL RCGDAGNL YR Sbjct: 85 NFHSRVPKLELALQESGVTMRAGLTERVLNRCGDAGNLGYR 125 >ref|XP_003546958.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like isoform X1 [Glycine max] gi|571514894|ref|XP_006597171.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like isoform X2 [Glycine max] gi|571514897|ref|XP_006597172.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like isoform X3 [Glycine max] Length = 654 Score = 108 bits (270), Expect = 1e-21 Identities = 55/91 (60%), Positives = 69/91 (75%), Gaps = 4/91 (4%) Frame = -1 Query: 263 HSDASYSNQ----NGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLE 96 H ++++ N N GL+ L + N H+ D DEFA+DVEK+YRILRK+HSRVPKLE Sbjct: 52 HCNSTFDNHGCLTNQFGLIRLQEISIN-HTDDHTHDEFASDVEKVYRILRKYHSRVPKLE 110 Query: 95 LALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 LAL+ESG+V+R G+ ERVL RCGDAGNLAYR Sbjct: 111 LALRESGVVVRPGLTERVLSRCGDAGNLAYR 141 >ref|NP_201383.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170571|sp|Q9FH87.1|PP447_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g65820 gi|9758569|dbj|BAB09050.1| unnamed protein product [Arabidopsis thaliana] gi|332010728|gb|AED98111.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 637 Score = 108 bits (269), Expect = 2e-21 Identities = 54/83 (65%), Positives = 63/83 (75%) Frame = -1 Query: 251 SYSNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGI 72 ++ NGIGLV L HN + + + DEFA+DVEK YRILRKFHSRVPKLELAL ESG+ Sbjct: 51 NFRRSNGIGLVCLEKS-HNDRTKNSKYDEFASDVEKSYRILRKFHSRVPKLELALNESGV 109 Query: 71 VMRAGMAERVLGRCGDAGNLAYR 3 +R G+ ERVL RCGDAGNL YR Sbjct: 110 ELRPGLIERVLNRCGDAGNLGYR 132 >emb|CAA16678.1| predicted protein [Arabidopsis thaliana] Length = 598 Score = 108 bits (269), Expect = 2e-21 Identities = 54/83 (65%), Positives = 63/83 (75%) Frame = -1 Query: 251 SYSNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGI 72 ++ NGIGLV L HN + + + DEFA+DVEK YRILRKFHSRVPKLELAL ESG+ Sbjct: 44 NFRRSNGIGLVCLEKS-HNDRTKNSKYDEFASDVEKSYRILRKFHSRVPKLELALNESGV 102 Query: 71 VMRAGMAERVLGRCGDAGNLAYR 3 +R G+ ERVL RCGDAGNL YR Sbjct: 103 ELRPGLIERVLNRCGDAGNLGYR 125 >ref|XP_002866691.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312526|gb|EFH42950.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 638 Score = 107 bits (268), Expect = 2e-21 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 1/84 (1%) Frame = -1 Query: 251 SYSNQNGIGLVYLN-SMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESG 75 ++ NGIGLV L + HN + + + DEFA+DVEK YRILRKFHSRVPKLELAL ESG Sbjct: 50 NFRRSNGIGLVCLEKNHNHNDRTKNSKYDEFASDVEKAYRILRKFHSRVPKLELALNESG 109 Query: 74 IVMRAGMAERVLGRCGDAGNLAYR 3 + +R G+ ERVL RCGDAGNL YR Sbjct: 110 VELRPGLIERVLNRCGDAGNLGYR 133 >ref|XP_006595472.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like, partial [Glycine max] Length = 656 Score = 106 bits (265), Expect = 5e-21 Identities = 54/90 (60%), Positives = 68/90 (75%), Gaps = 3/90 (3%) Frame = -1 Query: 263 HSDASYSNQ---NGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLEL 93 H +++ N N G + L + N H+ D+ DEFA+DVEK+YRILRK+HSRVPKLEL Sbjct: 55 HFKSTFDNNALTNQFGFIRLQEISIN-HTDDQTHDEFASDVEKVYRILRKYHSRVPKLEL 113 Query: 92 ALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 AL+ESG+V+R G+ ERVL RCGDAGNLAYR Sbjct: 114 ALRESGVVVRPGLTERVLNRCGDAGNLAYR 143 >gb|EXC12605.1| hypothetical protein L484_012982 [Morus notabilis] Length = 638 Score = 103 bits (258), Expect = 3e-20 Identities = 59/105 (56%), Positives = 71/105 (67%), Gaps = 2/105 (1%) Frame = -1 Query: 311 SDSPNYEPSI-SPRDHSHSDASYSNQ-NGIGLVYLNSMPHNGHSYDREVDEFAADVEKIY 138 S PN +P + SP+ S + N+ G V+L P D DEF+ DVEKIY Sbjct: 20 SSQPNTKPYLLSPQTQFSSTQNPHNRATGFSPVHLEQNPVVSDD-DETHDEFSGDVEKIY 78 Query: 137 RILRKFHSRVPKLELALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 RILRKFHSRV KLELALQESG+V+R+G+ ERVLGRCGDAG+L YR Sbjct: 79 RILRKFHSRVSKLELALQESGVVLRSGLTERVLGRCGDAGSLGYR 123 >gb|EOX91773.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 647 Score = 103 bits (258), Expect = 3e-20 Identities = 58/112 (51%), Positives = 77/112 (68%), Gaps = 9/112 (8%) Frame = -1 Query: 311 SDSPN-YEPSISPRDHSHSDASYS-------NQNGIGLVYLNS-MPHNGHSYDREVDEFA 159 S PN Y I P ++++++ S S +++G GLV L + P D++ D+FA Sbjct: 21 SSYPNTYHFHILPDNNNNNNNSNSLNLLSSNSKSGFGLVTLETKQPTLKSDNDQQTDDFA 80 Query: 158 ADVEKIYRILRKFHSRVPKLELALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 +DVEKIYRILRKFH+RVPKL LALQ+SG+V R G+ ERVL RCGDAGNL Y+ Sbjct: 81 SDVEKIYRILRKFHTRVPKLNLALQQSGVVFRPGLTERVLNRCGDAGNLGYK 132 >ref|XP_006393982.1| hypothetical protein EUTSA_v10003830mg [Eutrema salsugineum] gi|557090621|gb|ESQ31268.1| hypothetical protein EUTSA_v10003830mg [Eutrema salsugineum] Length = 620 Score = 103 bits (256), Expect = 6e-20 Identities = 52/83 (62%), Positives = 61/83 (73%) Frame = -1 Query: 251 SYSNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGI 72 ++ NG GLV L+ H + + DEFA+DVEK YRILRKFHSRVPKLELAL ESG+ Sbjct: 44 NFRRSNGTGLVCLDKS-HKERTKNSNHDEFASDVEKAYRILRKFHSRVPKLELALNESGV 102 Query: 71 VMRAGMAERVLGRCGDAGNLAYR 3 +R G+ ERVL RCGDAGNL YR Sbjct: 103 ELRPGLIERVLNRCGDAGNLGYR 125 >ref|XP_006348483.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49730-like [Solanum tuberosum] Length = 625 Score = 99.4 bits (246), Expect = 8e-19 Identities = 50/90 (55%), Positives = 64/90 (71%), Gaps = 1/90 (1%) Frame = -1 Query: 269 HSHSDASYSNQNGIGLVYLNSMPHNGHSY-DREVDEFAADVEKIYRILRKFHSRVPKLEL 93 H + +Y + G + S + ++ ++ DEF+ADVEK+YRILRKFHSRVPKLEL Sbjct: 21 HISPENAYVSSKGKSFYHSESTLLSSSTFLNKNHDEFSADVEKVYRILRKFHSRVPKLEL 80 Query: 92 ALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 AL ESG+V R+G+ ERVL RCGDAGNL YR Sbjct: 81 ALLESGVVARSGLTERVLNRCGDAGNLGYR 110 >ref|XP_004513407.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like isoform X1 [Cicer arietinum] gi|502165084|ref|XP_004513408.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like isoform X2 [Cicer arietinum] Length = 655 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/105 (46%), Positives = 74/105 (70%) Frame = -1 Query: 317 PQSDSPNYEPSISPRDHSHSDASYSNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIY 138 P + +PN++ + + + + GL++L S ++ + + + DEF +DVEK+Y Sbjct: 49 PPTPNPNFKTT-----------TITKNDQFGLIHLQSNANHFNDQNSD-DEFTSDVEKVY 96 Query: 137 RILRKFHSRVPKLELALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 RILRK+HSRVPKLELAL+ESG+V+ +G+ ERVL RCG++GNLAYR Sbjct: 97 RILRKYHSRVPKLELALKESGVVVSSGLTERVLNRCGNSGNLAYR 141 >ref|XP_006281497.1| hypothetical protein CARUB_v10027590mg [Capsella rubella] gi|482550201|gb|EOA14395.1| hypothetical protein CARUB_v10027590mg [Capsella rubella] Length = 634 Score = 98.2 bits (243), Expect = 2e-18 Identities = 52/86 (60%), Positives = 60/86 (69%) Frame = -1 Query: 260 SDASYSNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQE 81 S A N GLV L HN + + + D FA+DVE+ YRILRKFHSRVPKLELAL E Sbjct: 44 SKALEGNFRTSGLVCLEKS-HNERTKNSKYDAFASDVERAYRILRKFHSRVPKLELALDE 102 Query: 80 SGIVMRAGMAERVLGRCGDAGNLAYR 3 SG+ +R G+ ERVL RCGDAGNL YR Sbjct: 103 SGVELRPGLIERVLNRCGDAGNLGYR 128 >ref|XP_006466418.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g65820-like [Citrus sinensis] Length = 638 Score = 94.7 bits (234), Expect = 2e-17 Identities = 54/105 (51%), Positives = 66/105 (62%), Gaps = 10/105 (9%) Frame = -1 Query: 287 SISPR-----DHSHSDASYSNQNGIGLVYLNSMPH-----NGHSYDREVDEFAADVEKIY 138 S SPR H S A+ +NQ LV L + N +EF+ DVEKI+ Sbjct: 19 SFSPRPNTTTSHVESTATTTNQLNSNLVCLKTKEDDCKCDNTTDTHGSHNEFSHDVEKIF 78 Query: 137 RILRKFHSRVPKLELALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 RIL+KFHSR+PKLELALQ SG+V+R G+ ERV+ RCGDAGNL YR Sbjct: 79 RILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYR 123 >ref|XP_002877696.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323534|gb|EFH53955.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1188 Score = 94.7 bits (234), Expect = 2e-17 Identities = 49/83 (59%), Positives = 58/83 (69%) Frame = -1 Query: 251 SYSNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGI 72 S +NG+GLV+ ++ DEFA DVEKIYRILR +HSRVPKLEL+L ESGI Sbjct: 47 STERKNGLGLVFP----------EKHEDEFAGDVEKIYRILRNYHSRVPKLELSLNESGI 96 Query: 71 VMRAGMAERVLGRCGDAGNLAYR 3 +R G+ RVL RCGDAGNL YR Sbjct: 97 DLRPGLIVRVLSRCGDAGNLGYR 119 >ref|XP_006426145.1| hypothetical protein CICLE_v10025134mg [Citrus clementina] gi|557528135|gb|ESR39385.1| hypothetical protein CICLE_v10025134mg [Citrus clementina] Length = 638 Score = 94.4 bits (233), Expect = 3e-17 Identities = 53/105 (50%), Positives = 67/105 (63%), Gaps = 10/105 (9%) Frame = -1 Query: 287 SISPR-----DHSHSDASYSNQNGIGLVYLNSMP-----HNGHSYDREVDEFAADVEKIY 138 S +PR H S A+ +NQ LV L + +N +EF+ DVEKI+ Sbjct: 19 SFAPRPNTTTSHVESTATTTNQLNSNLVCLKTKEDDCKCNNTTDTHGSHNEFSHDVEKIF 78 Query: 137 RILRKFHSRVPKLELALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 RIL+KFHSR+PKLELALQ SG+V+R G+ ERV+ RCGDAGNL YR Sbjct: 79 RILKKFHSRLPKLELALQHSGVVLRPGLTERVINRCGDAGNLGYR 123 >gb|EPS62602.1| hypothetical protein M569_12187, partial [Genlisea aurea] Length = 593 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/56 (73%), Positives = 51/56 (91%) Frame = -1 Query: 170 DEFAADVEKIYRILRKFHSRVPKLELALQESGIVMRAGMAERVLGRCGDAGNLAYR 3 D+F+ADVEK+Y+ILRKF+S+VPKLELALQ SG+ +R+G+ ERVL RCGDAGNL YR Sbjct: 29 DDFSADVEKVYKILRKFNSKVPKLELALQHSGVSVRSGLTERVLNRCGDAGNLGYR 84 >ref|NP_190542.4| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546755|sp|P0C8A0.1|PP275_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49730 gi|332645062|gb|AEE78583.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 638 Score = 91.3 bits (225), Expect = 2e-16 Identities = 49/83 (59%), Positives = 56/83 (67%) Frame = -1 Query: 251 SYSNQNGIGLVYLNSMPHNGHSYDREVDEFAADVEKIYRILRKFHSRVPKLELALQESGI 72 S +NG+GLV ++ DEFA +VEKIYRILR HSRVPKLELAL ESGI Sbjct: 44 STERKNGVGLV----------CPEKHEDEFAGEVEKIYRILRNHHSRVPKLELALNESGI 93 Query: 71 VMRAGMAERVLGRCGDAGNLAYR 3 +R G+ RVL RCGDAGNL YR Sbjct: 94 DLRPGLIIRVLSRCGDAGNLGYR 116