BLASTX nr result
ID: Rheum21_contig00017254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00017254 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACH63237.1| pathogen-induced protein-like protein [Rheum aust... 105 8e-21 dbj|BAN15743.1| pyrabactin resistance [Dianthus caryophyllus] 71 1e-10 gb|EOY24998.1| Regulatory components of ABA receptor 3 [Theobrom... 71 2e-10 ref|XP_004308004.1| PREDICTED: abscisic acid receptor PYL8-like ... 71 2e-10 ref|XP_006476396.1| PREDICTED: abscisic acid receptor PYL8-like ... 70 3e-10 ref|XP_006439366.1| hypothetical protein CICLE_v10022206mg [Citr... 69 6e-10 ref|XP_006439365.1| hypothetical protein CICLE_v10022206mg [Citr... 69 6e-10 ref|XP_006439364.1| hypothetical protein CICLE_v10022206mg [Citr... 69 6e-10 ref|XP_006422129.1| hypothetical protein CICLE_v10005981mg [Citr... 68 1e-09 ref|XP_002318380.1| hypothetical protein POPTR_0012s01550g [Popu... 66 4e-09 gb|EMJ19666.1| hypothetical protein PRUPE_ppa011927mg [Prunus pe... 66 5e-09 ref|XP_002513580.1| conserved hypothetical protein [Ricinus comm... 66 5e-09 ref|NP_851180.1| regulatory component of ABA receptor 3 [Arabido... 65 9e-09 ref|NP_200128.1| regulatory component of ABA receptor 3 [Arabido... 65 9e-09 gb|AFK41699.1| unknown [Lotus japonicus] 65 9e-09 pdb|3RT0|C Chain C, Crystal Structure Of Pyl10-Hab1 Complex In T... 65 9e-09 pdb|3UQH|A Chain A, Crystal Strcuture Of Aba Receptor Pyl10 (Apo... 65 9e-09 dbj|BAF00266.1| hypothetical protein [Arabidopsis thaliana] 65 9e-09 ref|NP_194521.2| abscisic acid receptor PYL10 [Arabidopsis thali... 65 9e-09 emb|CAB36761.1| putative protein [Arabidopsis thaliana] gi|72696... 65 9e-09 >gb|ACH63237.1| pathogen-induced protein-like protein [Rheum australe] Length = 186 Score = 105 bits (261), Expect = 8e-21 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -2 Query: 144 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVRS 1 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVRS Sbjct: 1 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVRS 48 >dbj|BAN15743.1| pyrabactin resistance [Dianthus caryophyllus] Length = 197 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/46 (65%), Positives = 41/46 (89%) Frame = -2 Query: 141 NGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 NG G GG E+E+V+R+H+HV+AD+QC+SVL++HI AP+ LVWSLVR Sbjct: 10 NGCGGGGVEDEYVRRHHKHVIADNQCTSVLIKHIKAPVPLVWSLVR 55 >gb|EOY24998.1| Regulatory components of ABA receptor 3 [Theobroma cacao] Length = 193 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/47 (61%), Positives = 40/47 (85%) Frame = -2 Query: 144 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 MNG+G+ EEEF+KR+H+H + ++QC+S LV+HI AP+HLVWSLVR Sbjct: 9 MNGNGFSKMEEEFIKRHHKHDVKENQCTSSLVKHIKAPIHLVWSLVR 55 >ref|XP_004308004.1| PREDICTED: abscisic acid receptor PYL8-like [Fragaria vesca subsp. vesca] Length = 232 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/51 (62%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -2 Query: 147 KMNGD---GYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 KMNG+ G GG E+++R+H H L DHQCSS LV HI AP+HLVWSLVR Sbjct: 44 KMNGNNKNGGGGGASEYIRRHHRHELKDHQCSSTLVRHIKAPVHLVWSLVR 94 >ref|XP_006476396.1| PREDICTED: abscisic acid receptor PYL8-like [Citrus sinensis] Length = 197 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = -2 Query: 132 GYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 G+G +EE+++KR+H+H + DHQCSS LV+HI AP+HLVWSLVR Sbjct: 17 GFGKTEEDYIKRHHKHDVHDHQCSSTLVKHIKAPVHLVWSLVR 59 >ref|XP_006439366.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] gi|557541628|gb|ESR52606.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] Length = 168 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 3/50 (6%) Frame = -2 Query: 144 MNGDGYGGS---EEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 +NG G GG EE+++KR+H+H + DHQCSS LV+HI AP+HLVWSLVR Sbjct: 10 VNGSGSGGFGKIEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVR 59 >ref|XP_006439365.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] gi|557541627|gb|ESR52605.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] Length = 214 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 3/50 (6%) Frame = -2 Query: 144 MNGDGYGGS---EEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 +NG G GG EE+++KR+H+H + DHQCSS LV+HI AP+HLVWSLVR Sbjct: 10 VNGSGSGGFGKIEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVR 59 >ref|XP_006439364.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] gi|557541626|gb|ESR52604.1| hypothetical protein CICLE_v10022206mg [Citrus clementina] Length = 197 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 3/50 (6%) Frame = -2 Query: 144 MNGDGYGGS---EEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 +NG G GG EE+++KR+H+H + DHQCSS LV+HI AP+HLVWSLVR Sbjct: 10 VNGSGSGGFGKIEEDYIKRHHKHDVHDHQCSSSLVKHIKAPVHLVWSLVR 59 >ref|XP_006422129.1| hypothetical protein CICLE_v10005981mg [Citrus clementina] gi|568874912|ref|XP_006490556.1| PREDICTED: abscisic acid receptor PYL8-like [Citrus sinensis] gi|557524002|gb|ESR35369.1| hypothetical protein CICLE_v10005981mg [Citrus clementina] Length = 189 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -2 Query: 141 NGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 NG GG+E E ++R+H H +ADHQCSSVL +HI AP+HLVWSLVR Sbjct: 6 NGGINGGAESEHIRRHHIHDVADHQCSSVLKKHIRAPVHLVWSLVR 51 >ref|XP_002318380.1| hypothetical protein POPTR_0012s01550g [Populus trichocarpa] gi|222859053|gb|EEE96600.1| hypothetical protein POPTR_0012s01550g [Populus trichocarpa] Length = 191 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/51 (62%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -2 Query: 150 EKMNG-DGYGGSEEEFVKRYHEHV-LADHQCSSVLVEHINAPLHLVWSLVR 4 E NG G G E E+++R+H+H LADHQCSS LV+HI AP+HLVWSLVR Sbjct: 3 ENSNGRGGIGSVESEYIRRHHKHGDLADHQCSSALVKHIKAPVHLVWSLVR 53 >gb|EMJ19666.1| hypothetical protein PRUPE_ppa011927mg [Prunus persica] Length = 191 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 138 GDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 G G+GG E+++R+H+H DHQC+S LV HI AP+HLVWSLVR Sbjct: 9 GTGFGGIVGEYIRRHHKHDPKDHQCTSTLVRHIKAPVHLVWSLVR 53 >ref|XP_002513580.1| conserved hypothetical protein [Ricinus communis] gi|223547488|gb|EEF48983.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 138 GDGYGGS-EEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 G+G GS E E+V+R+H H ADHQCSS LV+HI AP+HLVWSLVR Sbjct: 12 GNGIIGSVESEYVRRHHRHDPADHQCSSALVKHIKAPVHLVWSLVR 57 >ref|NP_851180.1| regulatory component of ABA receptor 3 [Arabidopsis thaliana] gi|332008932|gb|AED96315.1| regulatory component of ABA receptor 3 [Arabidopsis thaliana] Length = 157 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -2 Query: 117 EEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 E EF++R+H+H L D+QCSS LV+HINAP+H+VWSLVR Sbjct: 15 EREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVR 52 >ref|NP_200128.1| regulatory component of ABA receptor 3 [Arabidopsis thaliana] gi|75170450|sp|Q9FGM1.1|PYL8_ARATH RecName: Full=Abscisic acid receptor PYL8; AltName: Full=ABI1-binding protein 1; AltName: Full=PYR1-like protein 8; AltName: Full=Regulatory components of ABA receptor 3 gi|9757997|dbj|BAB08419.1| unnamed protein product [Arabidopsis thaliana] gi|27808528|gb|AAO24544.1| At5g53160 [Arabidopsis thaliana] gi|332008933|gb|AED96316.1| regulatory component of ABA receptor 3 [Arabidopsis thaliana] Length = 188 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -2 Query: 117 EEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 E EF++R+H+H L D+QCSS LV+HINAP+H+VWSLVR Sbjct: 15 EREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVR 52 >gb|AFK41699.1| unknown [Lotus japonicus] Length = 185 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 144 MNGDG-YGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 MNGD Y E ++++R+H+H L D+QC+S LV+HI AP+HLVWSLVR Sbjct: 1 MNGDEPYSAIESQYIRRHHKHELRDNQCTSALVKHIKAPVHLVWSLVR 48 >pdb|3RT0|C Chain C, Crystal Structure Of Pyl10-Hab1 Complex In The Absence Of Abscisic Acid (Aba) gi|340708132|pdb|3RT0|D Chain D, Crystal Structure Of Pyl10-Hab1 Complex In The Absence Of Abscisic Acid (Aba) Length = 183 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 144 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 MNGD E E++K++H H L + QCSS LV+HI APLHLVWS+VR Sbjct: 1 MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVR 47 >pdb|3UQH|A Chain A, Crystal Strcuture Of Aba Receptor Pyl10 (Apo) gi|361132419|pdb|3UQH|B Chain B, Crystal Strcuture Of Aba Receptor Pyl10 (Apo) gi|364506012|pdb|3R6P|A Chain A, Crystal Structure Of Abscisic Acid-Bound Pyl10 Length = 191 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 144 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 MNGD E E++K++H H L + QCSS LV+HI APLHLVWS+VR Sbjct: 1 MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVR 47 >dbj|BAF00266.1| hypothetical protein [Arabidopsis thaliana] Length = 188 Score = 65.1 bits (157), Expect = 9e-09 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -2 Query: 117 EEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 E EF++R+H+H L D+QCSS LV+HINAP+H+VWSLVR Sbjct: 15 EREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVR 52 >ref|NP_194521.2| abscisic acid receptor PYL10 [Arabidopsis thaliana] gi|75151959|sp|Q8H1R0.1|PYL10_ARATH RecName: Full=Abscisic acid receptor PYL10; AltName: Full=ABI1-binding protein 8; AltName: Full=PYR1-like protein 10; AltName: Full=Regulatory components of ABA receptor 4 gi|340708133|pdb|3RT2|A Chain A, Crystal Structure Of Apo-Pyl10 gi|23296488|gb|AAN13069.1| unknown protein [Arabidopsis thaliana] gi|332660009|gb|AEE85409.1| abscisic acid receptor PYL10 [Arabidopsis thaliana] Length = 183 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 144 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 MNGD E E++K++H H L + QCSS LV+HI APLHLVWS+VR Sbjct: 1 MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVR 47 >emb|CAB36761.1| putative protein [Arabidopsis thaliana] gi|7269646|emb|CAB79594.1| putative protein [Arabidopsis thaliana] Length = 192 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -2 Query: 144 MNGDGYGGSEEEFVKRYHEHVLADHQCSSVLVEHINAPLHLVWSLVR 4 MNGD E E++K++H H L + QCSS LV+HI APLHLVWS+VR Sbjct: 1 MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVR 47