BLASTX nr result
ID: Rheum21_contig00015686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00015686 (659 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACP39958.1| pentatricopeptide repeat protein [Gossypium hirsu... 83 6e-14 gb|EOY24258.1| Tetratricopeptide repeat-like superfamily protein... 82 2e-13 ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citr... 79 1e-12 ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_006359252.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_006359251.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 gb|EXC02094.1| hypothetical protein L484_024059 [Morus notabilis] 76 8e-12 ref|XP_002326464.1| predicted protein [Populus trichocarpa] gi|5... 75 1e-11 ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 emb|CBI25851.3| unnamed protein product [Vitis vinifera] 74 3e-11 ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 gb|EMJ13638.1| hypothetical protein PRUPE_ppa016777mg, partial [... 73 7e-11 ref|XP_004245793.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_002531466.1| pentatricopeptide repeat-containing protein,... 70 6e-10 gb|ESW03282.1| hypothetical protein PHAVU_011G001300g [Phaseolus... 69 2e-09 ref|XP_004300367.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_002863348.1| pentatricopeptide repeat-containing protein ... 68 3e-09 ref|XP_003604902.1| Pentatricopeptide repeat-containing protein ... 67 4e-09 ref|NP_199547.1| pentatricopeptide repeat-containing protein [Ar... 67 5e-09 >gb|ACP39958.1| pentatricopeptide repeat protein [Gossypium hirsutum] gi|227463014|gb|ACP39959.1| pentatricopeptide repeat protein [Gossypium hirsutum] Length = 288 Score = 83.2 bits (204), Expect = 6e-14 Identities = 43/104 (41%), Positives = 66/104 (63%), Gaps = 5/104 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 S KP S++I+ +C EGR LDGF LY +++ ++++D+Y++LL GLCRQ+ Sbjct: 183 SGAKPSGIACSTMIREICHEGRVLDGFCLYNEIERMQYISSIDTDIYSILLVGLCRQSHS 242 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRI 299 EA KLA LM RRI+++ ++ II L S + EL++ L RI Sbjct: 243 VEAVKLARLMLRRRIRLEAPYVDEIIKHLKNSTDKELVTQLSRI 286 >gb|EOY24258.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777003|gb|EOY24259.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777004|gb|EOY24260.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508777005|gb|EOY24261.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 483 Score = 81.6 bits (200), Expect = 2e-13 Identities = 42/104 (40%), Positives = 67/104 (64%), Gaps = 5/104 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 + KPD+ S +I+ +C EGR LDGF LY +++ ++++D+Y++LL GLCRQ+ Sbjct: 370 TGAKPDSIACSIMIREICQEGRVLDGFYLYEEIERMRYLSSIDADIYSILLVGLCRQSHS 429 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRI 299 EAAKLA M E+RI++K ++ II L + +L++ L RI Sbjct: 430 VEAAKLARSMLEKRIRLKAPYVDKIIEHLKNCGDKQLVTELGRI 473 >ref|XP_006440247.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895520|ref|XP_006440248.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|567895522|ref|XP_006440249.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542509|gb|ESR53487.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542510|gb|ESR53488.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] gi|557542511|gb|ESR53489.1| hypothetical protein CICLE_v10019985mg [Citrus clementina] Length = 475 Score = 79.0 bits (193), Expect = 1e-12 Identities = 43/104 (41%), Positives = 68/104 (65%), Gaps = 5/104 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 S VKPD S +I+ LCL G+ L+GF LY ++K +V+SD++++LL GLCR+N Sbjct: 370 SGVKPDGLACSVMIRELCLRGQVLEGFCLYEDIEKIGFLSSVDSDIHSVLLLGLCRKNHS 429 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRI 299 EAAKLA M ++RI ++ ++ I+ L S + EL+++L +I Sbjct: 430 VEAAKLARFMLKKRIWLQGPYVDKIVEHLKKSGDEELITNLPKI 473 >ref|XP_004139002.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] gi|449505643|ref|XP_004162530.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cucumis sativus] Length = 475 Score = 79.0 bits (193), Expect = 1e-12 Identities = 45/105 (42%), Positives = 66/105 (62%), Gaps = 5/105 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 + VKPD S +I+ LCLE R LDGFNL VD+ ++++D+Y+LLL GLC + Sbjct: 370 NGVKPDGVACSLMIRELCLEERVLDGFNLCYEVDRNGYLCSIDADIYSLLLVGLCEHDHS 429 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRIQ 302 +AAKLA LM ++ I++KP E+II L ++ EL+ L I+ Sbjct: 430 VDAAKLARLMLKKGIRLKPHYAESIIKHLKKFEDRELVMHLGGIR 474 >ref|XP_006359252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X2 [Solanum tuberosum] Length = 487 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/96 (41%), Positives = 66/96 (68%), Gaps = 2/96 (2%) Frame = +3 Query: 9 VKPDTATSSSLIKALCLEGRALDGFNLY--GSVDKTVNSDVYALLLDGLCRQNCVSEAAK 182 +KPD+ TSS++I+ LC + R LDG++L + +++SD+Y++L+ GLC N ++EAAK Sbjct: 377 LKPDSFTSSTIIRWLCQQNRILDGYHLIEQSASVSSIDSDIYSILMAGLCEANHLAEAAK 436 Query: 183 LASLMNERRIQVKPSCIETIISRLDGSQELELLSSL 290 LA LM E+RIQ+K C++ + L + +L SS+ Sbjct: 437 LAHLMVEKRIQLKGPCVKNVTECLRHCGKEDLASSI 472 >ref|XP_006359251.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X1 [Solanum tuberosum] Length = 488 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/96 (41%), Positives = 66/96 (68%), Gaps = 2/96 (2%) Frame = +3 Query: 9 VKPDTATSSSLIKALCLEGRALDGFNLY--GSVDKTVNSDVYALLLDGLCRQNCVSEAAK 182 +KPD+ TSS++I+ LC + R LDG++L + +++SD+Y++L+ GLC N ++EAAK Sbjct: 377 LKPDSFTSSTIIRWLCQQNRILDGYHLIEQSASVSSIDSDIYSILMAGLCEANHLAEAAK 436 Query: 183 LASLMNERRIQVKPSCIETIISRLDGSQELELLSSL 290 LA LM E+RIQ+K C++ + L + +L SS+ Sbjct: 437 LAHLMVEKRIQLKGPCVKNVTECLRHCGKEDLASSI 472 >ref|XP_006477135.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X1 [Citrus sinensis] gi|568846596|ref|XP_006477136.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X2 [Citrus sinensis] gi|568846598|ref|XP_006477137.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform X3 [Citrus sinensis] Length = 475 Score = 78.2 bits (191), Expect = 2e-12 Identities = 43/104 (41%), Positives = 68/104 (65%), Gaps = 5/104 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 S VKPD S +I+ LCL G+ L+GF LY ++K +V+SD++++LL GLCR+N Sbjct: 370 SGVKPDGLACSVMIRELCLGGQVLEGFCLYEDIEKIGFLSSVDSDIHSVLLLGLCRKNHS 429 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRI 299 EAAKLA M ++RI ++ ++ I+ L S + EL+++L +I Sbjct: 430 VEAAKLARFMLKKRIWLQGPYVDKIVEHLKKSGDEELITNLPKI 473 >gb|EXC02094.1| hypothetical protein L484_024059 [Morus notabilis] Length = 474 Score = 76.3 bits (186), Expect = 8e-12 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 5/104 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 + +KPD+ + +IK LCL GR LDG+ L ++K +++SDVY+LL+ GLC+Q + Sbjct: 369 NGLKPDSLACTIVIKELCLIGRVLDGYQLCDEIEKIGFWSSIDSDVYSLLIVGLCQQGHL 428 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRI 299 EAA L SLM ++ IQ+ ++ I+ L S + EL+ L RI Sbjct: 429 VEAANLVSLMLKKGIQLSAPYVDRIVEILKKSGDEELIHHLTRI 472 >ref|XP_002326464.1| predicted protein [Populus trichocarpa] gi|566149164|ref|XP_006368989.1| hypothetical protein POPTR_0001s15470g [Populus trichocarpa] gi|550347348|gb|ERP65558.1| hypothetical protein POPTR_0001s15470g [Populus trichocarpa] Length = 476 Score = 75.5 bits (184), Expect = 1e-11 Identities = 41/101 (40%), Positives = 62/101 (61%), Gaps = 5/101 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDKT-----VNSDVYALLLDGLCRQNCV 167 S +KPD+ S +I+ +C E R LDGF LY V+KT ++ D+Y++LL GLC+Q Sbjct: 371 SGMKPDSLACSMMIREICSEKRVLDGFCLYEEVEKTGCLSSIDIDIYSILLAGLCQQGHS 430 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSL 290 +EAA+LA M E+RI ++ +E I+ L EL++ L Sbjct: 431 AEAARLARSMLEKRIPLRAPHVEKIVEHLKNFGGKELVAEL 471 >ref|XP_003631455.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Vitis vinifera] Length = 638 Score = 75.1 bits (183), Expect = 2e-11 Identities = 42/101 (41%), Positives = 63/101 (62%), Gaps = 5/101 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDKT-----VNSDVYALLLDGLCRQNCV 167 ++VKPD +LIKALCLEGR LDGF+L+ + ++SD+Y++LL GL ++ Sbjct: 366 NAVKPDGLACGTLIKALCLEGRVLDGFHLFDEFENMEGLSYLDSDIYSILLVGLSQKRHS 425 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSL 290 EA KLA LM +R IQ+K ++I+ L S + E++ L Sbjct: 426 VEAVKLARLMVDRGIQLKTPYFDSIVEHLKESGDKEIVMYL 466 >emb|CBI25851.3| unnamed protein product [Vitis vinifera] Length = 528 Score = 74.3 bits (181), Expect = 3e-11 Identities = 41/97 (42%), Positives = 61/97 (62%), Gaps = 5/97 (5%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDKT-----VNSDVYALLLDGLCRQNCV 167 ++VKPD +LIKALCLEGR LDGF+L+ + ++SD+Y++LL GL ++ Sbjct: 372 NAVKPDGLACGTLIKALCLEGRVLDGFHLFDEFENMEGLSYLDSDIYSILLVGLSQKRHS 431 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELEL 278 EA KLA LM +R IQ+K ++I+ L S + E+ Sbjct: 432 VEAVKLARLMVDRGIQLKTPYFDSIVEHLKESGDKEI 468 >ref|XP_004515635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Cicer arietinum] Length = 477 Score = 73.9 bits (180), Expect = 4e-11 Identities = 38/102 (37%), Positives = 65/102 (63%), Gaps = 5/102 (4%) Frame = +3 Query: 9 VKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCVSE 173 +KPDT SS L+K CL+ R LDGF L +++ +++SD+Y++LL GLCR+N + E Sbjct: 372 IKPDTLASSLLLKEFCLKDRVLDGFYLLDAIENKGFLSSIDSDIYSILLVGLCRENHLME 431 Query: 174 AAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRI 299 A KLA++M ++ + ++P ++ I L+ E +++ L I Sbjct: 432 ATKLATIMLKKGVSLRPPYRDSAIDVLNKYGEKGIVNQLTGI 473 >gb|EMJ13638.1| hypothetical protein PRUPE_ppa016777mg, partial [Prunus persica] Length = 394 Score = 73.2 bits (178), Expect = 7e-11 Identities = 39/98 (39%), Positives = 63/98 (64%), Gaps = 5/98 (5%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 S +KP++ S ++K +CLEGR +DGF L+ ++K +++SD Y++LL GLC Q + Sbjct: 295 SGLKPNSLACSIMLKKVCLEGRVIDGFCLFDELEKMECLSSIDSDTYSILLVGLCEQRHL 354 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELL 281 EAAKLA LM + I++K +++I L S + EL+ Sbjct: 355 LEAAKLARLMLNKGIKLKAPYVDSIAEILKKSGDEELV 392 >ref|XP_004245793.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like [Solanum lycopersicum] Length = 480 Score = 70.5 bits (171), Expect = 4e-10 Identities = 39/101 (38%), Positives = 68/101 (67%), Gaps = 2/101 (1%) Frame = +3 Query: 9 VKPDTATSSSLIKALCLEGRALDGFNLY--GSVDKTVNSDVYALLLDGLCRQNCVSEAAK 182 +KPD+ TSS++I+ LC + R LDG++L + +++SD+Y++L+ GLC N ++EAA Sbjct: 381 LKPDSYTSSTIIRWLCQQNRILDGYHLIEQSASVSSIDSDIYSVLMAGLCDANHLAEAAN 440 Query: 183 LASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRIQN 305 LA LM E+RIQ+K ++ +I L + +L SS+ +++ Sbjct: 441 LAHLMVEKRIQLK-GPVKNVIECLRRCGKEDLASSIGNVKS 480 >ref|XP_002531466.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528920|gb|EEF30916.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 518 Score = 70.1 bits (170), Expect = 6e-10 Identities = 39/104 (37%), Positives = 60/104 (57%), Gaps = 5/104 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 S VKPD S +IK LC R LDG+ L+ ++K T++SD Y++LL GLC+Q Sbjct: 369 SGVKPDGLACSLMIKELCFVNRVLDGYCLHDEIEKIGSLSTIDSDTYSVLLVGLCQQGYS 428 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRI 299 EAAKLA + E+RI +K ++ ++ + +L++ L I Sbjct: 429 LEAAKLARSLIEKRIHLKHPYVDKVVEYMKKFGVTDLVTELASI 472 >gb|ESW03282.1| hypothetical protein PHAVU_011G001300g [Phaseolus vulgaris] Length = 474 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/103 (34%), Positives = 67/103 (65%), Gaps = 5/103 (4%) Frame = +3 Query: 9 VKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCVSE 173 V+PD+ SS L+K LC++ + LDGF+L +++ T+++ +Y++LL GLC++N ++E Sbjct: 369 VRPDSLASSLLLKELCMKDQVLDGFHLLEAMENKGCLSTIDNGIYSILLVGLCQRNHLTE 428 Query: 174 AAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKRIQ 302 A KLA +M ++ + ++P + I L S E +L++ L I+ Sbjct: 429 ATKLAKIMLKKSVPLQPPYKDGAIDILIKSGEKDLVNQLTCIR 471 >ref|XP_004300367.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform 1 [Fragaria vesca subsp. vesca] gi|470128894|ref|XP_004300368.1| PREDICTED: pentatricopeptide repeat-containing protein At5g47360-like isoform 2 [Fragaria vesca subsp. vesca] Length = 421 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/103 (36%), Positives = 63/103 (61%), Gaps = 5/103 (4%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCV 167 S VKP++ + ++K CLEGR +D + L+G ++K ++ SD Y++LL GLC+Q + Sbjct: 318 SGVKPNSLVCTIMLKKCCLEGRMVDAYCLFGELEKMECLSSIESDTYSILLLGLCQQRHL 377 Query: 168 SEAAKLASLMNERRIQVKPSCIETIISRLDGSQELELLSSLKR 296 EAA+LA +M + I++K ++ I L S + EL+ L R Sbjct: 378 VEAAELARVMLSKGIKLKGPYVDIISEVLVKSGDEELVKQLTR 420 >ref|XP_002863348.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309183|gb|EFH39607.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 477 Score = 67.8 bits (164), Expect = 3e-09 Identities = 38/97 (39%), Positives = 61/97 (62%), Gaps = 5/97 (5%) Frame = +3 Query: 9 VKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCVSE 173 ++PD + + + LCL R LD F LY ++K T++SD+YA+LL GLC+Q E Sbjct: 376 IRPDGLACTHVFRELCLSERYLDCFVLYQEIEKEDVKSTMDSDIYAVLLLGLCQQGNSWE 435 Query: 174 AAKLASLMNERRIQVKPSCIETIISRLDGSQELELLS 284 AAKLA M ++++++K S +E II L + + +L+S Sbjct: 436 AAKLAKSMLDKKMRLKVSHVEKIIEALKKTGDEDLMS 472 >ref|XP_003604902.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355505957|gb|AES87099.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 449 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/79 (40%), Positives = 55/79 (69%), Gaps = 5/79 (6%) Frame = +3 Query: 3 SSVKPDTATSSSLIKALCLEGRALDGFNLYGSVD-----KTVNSDVYALLLDGLCRQNCV 167 + +KPDT SS L+K LCL+ R LDGF L +++ +++SD+Y+++L GL ++N + Sbjct: 345 AEIKPDTLASSLLLKELCLKDRVLDGFYLLDTIENMGFLSSIDSDIYSIMLIGLWQKNHL 404 Query: 168 SEAAKLASLMNERRIQVKP 224 +EA KLA +M ++ I ++P Sbjct: 405 TEATKLAKIMLKKAIPLRP 423 >ref|NP_199547.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180684|sp|Q9LVS3.1|PP422_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g47360 gi|8809619|dbj|BAA97170.1| unnamed protein product [Arabidopsis thaliana] gi|332008119|gb|AED95502.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 477 Score = 67.0 bits (162), Expect = 5e-09 Identities = 39/97 (40%), Positives = 61/97 (62%), Gaps = 5/97 (5%) Frame = +3 Query: 9 VKPDTATSSSLIKALCLEGRALDGFNLYGSVDK-----TVNSDVYALLLDGLCRQNCVSE 173 V+PD S + + LCL R LD F LY ++K T++SD++A+LL GLC+Q E Sbjct: 376 VRPDGLACSHVFRELCLLERYLDCFLLYQEIEKKDVKSTIDSDIHAVLLLGLCQQGNSWE 435 Query: 174 AAKLASLMNERRIQVKPSCIETIISRLDGSQELELLS 284 AAKLA M ++++++K S +E II L + + +L+S Sbjct: 436 AAKLAKSMLDKKMRLKVSHVEKIIEALKKTGDEDLMS 472