BLASTX nr result
ID: Rheum21_contig00014769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00014769 (211 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ19258.1| hypothetical protein PRUPE_ppa006808mg [Prunus pe... 56 4e-06 >gb|EMJ19258.1| hypothetical protein PRUPE_ppa006808mg [Prunus persica] Length = 394 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/67 (44%), Positives = 45/67 (67%) Frame = -1 Query: 205 DTDGSDGSGQNYRLLTKSDSYGVDKERAGVDYGMNEEDTDGLKKDIRELEEMLTKLNPMA 26 DT+G D + + KS YG+D+ GV G + +++ K+D+R+LEE+L+KLNPMA Sbjct: 85 DTNGVDN---HQMVAVKSGGYGIDQRSNGVRNGGDGDES--FKRDMRDLEELLSKLNPMA 139 Query: 25 EEFVPSS 5 +EFVP S Sbjct: 140 KEFVPPS 146