BLASTX nr result
ID: Rheum21_contig00013194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00013194 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852557.1| hypothetical protein AMTR_s00021p00198880 [A... 56 4e-06 ref|XP_003535402.1| PREDICTED: OPA3-like protein-like isoform X1... 55 1e-05 >ref|XP_006852557.1| hypothetical protein AMTR_s00021p00198880 [Amborella trichopoda] gi|548856168|gb|ERN14024.1| hypothetical protein AMTR_s00021p00198880 [Amborella trichopoda] Length = 171 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/60 (46%), Positives = 43/60 (71%) Frame = -3 Query: 416 EIEAIEQQNMNLATEVELLKHRLDDLEQQIKGRGLAAIFTTKNKNNQLVAKEDIKPASAS 237 E+EA+ Q++ +LA EVELLKH++++LE KGRGLA +F K+ +A ED +P +A+ Sbjct: 115 ELEALRQRDEDLAKEVELLKHKIEELEHLAKGRGLAGVFNFKH----TLAGEDSRPTAAA 170 >ref|XP_003535402.1| PREDICTED: OPA3-like protein-like isoform X1 [Glycine max] Length = 169 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/48 (50%), Positives = 35/48 (72%) Frame = -3 Query: 416 EIEAIEQQNMNLATEVELLKHRLDDLEQQIKGRGLAAIFTTKNKNNQL 273 E++ ++Q+N NLA EVELLKHR+ +LEQ +GRGL I +N N ++ Sbjct: 115 ELQDVKQKNENLAEEVELLKHRIQELEQMARGRGLIGILNFRNGNTEI 162