BLASTX nr result
ID: Rheum21_contig00013186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00013186 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270963.2| PREDICTED: pentatricopeptide repeat-containi... 106 3e-21 emb|CBI29222.3| unnamed protein product [Vitis vinifera] 106 3e-21 ref|XP_006432869.1| hypothetical protein CICLE_v10000274mg [Citr... 102 7e-20 gb|EMJ18352.1| hypothetical protein PRUPE_ppa001463mg [Prunus pe... 97 2e-18 ref|XP_002303480.2| pentatricopeptide repeat-containing family p... 93 3e-17 ref|XP_006351033.1| PREDICTED: pentatricopeptide repeat-containi... 86 5e-15 ref|XP_004249905.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 sp|Q940A6.2|PP325_ARATH RecName: Full=Pentatricopeptide repeat-c... 75 1e-11 emb|CAA18631.1| putative protein [Arabidopsis thaliana] gi|72687... 75 1e-11 ref|NP_567587.1| pentatricopeptide repeat-containing protein [Ar... 75 1e-11 ref|XP_006413978.1| hypothetical protein EUTSA_v10024401mg [Eutr... 74 2e-11 gb|EOY25407.1| Tetratricopeptide repeat-like superfamily protein... 72 8e-11 ref|XP_006282558.1| hypothetical protein CARUB_v10004123mg [Caps... 72 1e-10 ref|XP_002867936.1| hypothetical protein ARALYDRAFT_492917 [Arab... 72 1e-10 ref|XP_003548529.2| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_004149000.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 gb|ESW28323.1| hypothetical protein PHAVU_003G277400g [Phaseolus... 66 4e-09 gb|AHB18408.1| pentatricopeptide repeat-containing protein [Goss... 66 6e-09 ref|XP_004509525.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_003628993.1| Pentatricopeptide repeat-containing protein ... 60 3e-07 >ref|XP_002270963.2| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Vitis vinifera] Length = 1022 Score = 106 bits (265), Expect = 3e-21 Identities = 51/97 (52%), Positives = 70/97 (72%) Frame = +1 Query: 1 SPLETRANQPEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNP 180 SPL ++ NQP D +++K VTSIL NPSLD +QC+Q+ LSP FD + ++ +VNP Sbjct: 101 SPLPSQ-NQPPSSDHALLKSVTSILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNVNP 159 Query: 181 KTALKFFYVGAESCGFGFSVRSYCVLMRLLVASDMIA 291 KTAL FFY ++SCGF F++RSYCVLMR L+ S ++ Sbjct: 160 KTALNFFYFASDSCGFRFTLRSYCVLMRSLIVSGFVS 196 >emb|CBI29222.3| unnamed protein product [Vitis vinifera] Length = 826 Score = 106 bits (265), Expect = 3e-21 Identities = 51/97 (52%), Positives = 70/97 (72%) Frame = +1 Query: 1 SPLETRANQPEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNP 180 SPL ++ NQP D +++K VTSIL NPSLD +QC+Q+ LSP FD + ++ +VNP Sbjct: 34 SPLPSQ-NQPPSSDHALLKSVTSILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNVNP 92 Query: 181 KTALKFFYVGAESCGFGFSVRSYCVLMRLLVASDMIA 291 KTAL FFY ++SCGF F++RSYCVLMR L+ S ++ Sbjct: 93 KTALNFFYFASDSCGFRFTLRSYCVLMRSLIVSGFVS 129 >ref|XP_006432869.1| hypothetical protein CICLE_v10000274mg [Citrus clementina] gi|568835123|ref|XP_006471629.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Citrus sinensis] gi|568835125|ref|XP_006471630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X2 [Citrus sinensis] gi|557534991|gb|ESR46109.1| hypothetical protein CICLE_v10000274mg [Citrus clementina] Length = 833 Score = 102 bits (253), Expect = 7e-20 Identities = 46/88 (52%), Positives = 67/88 (76%) Frame = +1 Query: 28 PEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYV 207 P+ +QS++KWV+S+L SLDPS+C+ LSP FD + I+S+VNPKTALKFFY Sbjct: 47 PQSSNQSLLKWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTALKFFYF 106 Query: 208 GAESCGFGFSVRSYCVLMRLLVASDMIA 291 ++SC F F+VRSYC+L+RLL+ S++++ Sbjct: 107 ASQSCNFRFTVRSYCLLIRLLLFSNLLS 134 >gb|EMJ18352.1| hypothetical protein PRUPE_ppa001463mg [Prunus persica] Length = 821 Score = 97.4 bits (241), Expect = 2e-18 Identities = 46/89 (51%), Positives = 65/89 (73%) Frame = +1 Query: 25 QPEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFY 204 +P+ +QS+ WV+SIL PSLD S+C+ + LS FDR+ C I S+VNPKTAL FFY Sbjct: 45 EPQPPNQSLHNWVSSILSKPSLDSSKCKALIPLLSSHEFDRVFCSISSNVNPKTALHFFY 104 Query: 205 VGAESCGFGFSVRSYCVLMRLLVASDMIA 291 +ES F F+VRS+CVL+RLL+ S++++ Sbjct: 105 FASESFKFQFTVRSFCVLVRLLILSNLVS 133 >ref|XP_002303480.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550342907|gb|EEE78459.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 842 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/95 (47%), Positives = 69/95 (72%) Frame = +1 Query: 7 LETRANQPEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKT 186 L+T+ N P+ +QS++K V+ IL NPSLD ++C+++ LSP FD ++S+VNPKT Sbjct: 50 LQTQTN-PQALNQSLLKRVSLILSNPSLDCAKCKELVPHLSPQEFDSCFLALKSNVNPKT 108 Query: 187 ALKFFYVGAESCGFGFSVRSYCVLMRLLVASDMIA 291 AL FF+ +E+C F F+ RSYCVL+ LLV +D+++ Sbjct: 109 ALNFFHFVSETCKFRFTARSYCVLIHLLVGNDLLS 143 >ref|XP_006351033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Solanum tuberosum] Length = 928 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/86 (47%), Positives = 56/86 (65%) Frame = +1 Query: 25 QPEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFY 204 Q D ++ KWV S+L NP +D + + + L+P FD I +I SS+ P LKFF+ Sbjct: 143 QKNGLDLNLRKWVVSVLSNPPVDSLKIKDLLTLLTPQQFDAIFLEIYSSLKPLNVLKFFH 202 Query: 205 VGAESCGFGFSVRSYCVLMRLLVASD 282 V + +CGF FSVRSYC L+RLLVAS+ Sbjct: 203 VASGTCGFSFSVRSYCTLLRLLVASN 228 >ref|XP_004249905.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Solanum lycopersicum] Length = 839 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/81 (44%), Positives = 54/81 (66%) Frame = +1 Query: 40 DQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAES 219 D ++ KWV S+L +P +D + + + L+P FD I +I SS+ P LKFF+V + + Sbjct: 59 DLNLRKWVVSVLSDPPVDSLKIKDLLTLLNPQQFDAIFLEIHSSLKPLNVLKFFHVASGT 118 Query: 220 CGFGFSVRSYCVLMRLLVASD 282 C F F+VRSYC L+RLL+AS+ Sbjct: 119 CSFSFTVRSYCTLVRLLIASN 139 >sp|Q940A6.2|PP325_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g19440, chloroplastic; Flags: Precursor Length = 838 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/84 (42%), Positives = 59/84 (70%) Frame = +1 Query: 40 DQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAES 219 D+ + + ++S+L SLD QC+Q+ LSP FDR+ + +S VNPKTAL FF + ++S Sbjct: 73 DRHLHERLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDS 132 Query: 220 CGFGFSVRSYCVLMRLLVASDMIA 291 F FS+RSYC+L+ LL+ +++++ Sbjct: 133 FSFSFSLRSYCLLIGLLLDANLLS 156 >emb|CAA18631.1| putative protein [Arabidopsis thaliana] gi|7268739|emb|CAB78946.1| putative protein [Arabidopsis thaliana] Length = 814 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/84 (42%), Positives = 59/84 (70%) Frame = +1 Query: 40 DQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAES 219 D+ + + ++S+L SLD QC+Q+ LSP FDR+ + +S VNPKTAL FF + ++S Sbjct: 49 DRHLHERLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDS 108 Query: 220 CGFGFSVRSYCVLMRLLVASDMIA 291 F FS+RSYC+L+ LL+ +++++ Sbjct: 109 FSFSFSLRSYCLLIGLLLDANLLS 132 >ref|NP_567587.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186696|ref|NP_001190771.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|15810161|gb|AAL07224.1| unknown protein [Arabidopsis thaliana] gi|332658782|gb|AEE84182.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658783|gb|AEE84183.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 825 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/84 (42%), Positives = 59/84 (70%) Frame = +1 Query: 40 DQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAES 219 D+ + + ++S+L SLD QC+Q+ LSP FDR+ + +S VNPKTAL FF + ++S Sbjct: 60 DRHLHERLSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDS 119 Query: 220 CGFGFSVRSYCVLMRLLVASDMIA 291 F FS+RSYC+L+ LL+ +++++ Sbjct: 120 FSFSFSLRSYCLLIGLLLDANLLS 143 >ref|XP_006413978.1| hypothetical protein EUTSA_v10024401mg [Eutrema salsugineum] gi|557115148|gb|ESQ55431.1| hypothetical protein EUTSA_v10024401mg [Eutrema salsugineum] Length = 837 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/84 (42%), Positives = 57/84 (67%) Frame = +1 Query: 40 DQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAES 219 D+ + + +++ L SLD QC+Q+ LSP FDR+ D +S VNPKTAL FF + ++S Sbjct: 70 DRHLRERLSAALSRRSLDYEQCKQLIATLSPHEFDRLFPDFRSKVNPKTALDFFRLASDS 129 Query: 220 CGFGFSVRSYCVLMRLLVASDMIA 291 F FS+RSYC+L+ LL+ + +++ Sbjct: 130 FSFSFSLRSYCLLIGLLLDASLLS 153 >gb|EOY25407.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778152|gb|EOY25408.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778153|gb|EOY25409.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778154|gb|EOY25410.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778155|gb|EOY25411.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778156|gb|EOY25412.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 845 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/81 (43%), Positives = 54/81 (66%) Frame = +1 Query: 40 DQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAES 219 +Q ++ ++ IL SLD S+C+Q+ LSP FDR I S +NPKT L FFY+ ++S Sbjct: 64 NQGLLGRLSCILSKSSLDSSKCKQLLPLLSPLDFDRFFSAISSHLNPKTTLHFFYLASQS 123 Query: 220 CGFGFSVRSYCVLMRLLVASD 282 F F++RSYC+L+ LL+ ++ Sbjct: 124 FNFRFTLRSYCILILLLLLAN 144 >ref|XP_006282558.1| hypothetical protein CARUB_v10004123mg [Capsella rubella] gi|482551263|gb|EOA15456.1| hypothetical protein CARUB_v10004123mg [Capsella rubella] Length = 838 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/77 (44%), Positives = 54/77 (70%) Frame = +1 Query: 61 VTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAESCGFGFSV 240 ++S+L SLD C+Q+ LSP FDR+ + +S VNPKTAL FF + ++S F FS+ Sbjct: 77 LSSVLSKRSLDYELCKQLITVLSPLEFDRLFPEFRSKVNPKTALNFFRLASDSFSFSFSL 136 Query: 241 RSYCVLMRLLVASDMIA 291 RSYC+L+ LL+ +++++ Sbjct: 137 RSYCLLIGLLLDANLLS 153 >ref|XP_002867936.1| hypothetical protein ARALYDRAFT_492917 [Arabidopsis lyrata subsp. lyrata] gi|297313772|gb|EFH44195.1| hypothetical protein ARALYDRAFT_492917 [Arabidopsis lyrata subsp. lyrata] Length = 817 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/82 (42%), Positives = 56/82 (68%) Frame = +1 Query: 40 DQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAES 219 D+ + + ++S+L SLD QC+Q+ LSP FDR+ + + VNPKTAL FF + ++S Sbjct: 49 DRHLHERLSSVLSKRSLDYEQCKQLITVLSPHEFDRLFPEFRFKVNPKTALDFFRLASDS 108 Query: 220 CGFGFSVRSYCVLMRLLVASDM 285 F FS+RSYC+L+ LL+ +++ Sbjct: 109 FSFSFSLRSYCLLIGLLLDANL 130 >ref|XP_003548529.2| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Glycine max] Length = 840 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/76 (40%), Positives = 47/76 (61%) Frame = +1 Query: 61 VTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAESCGFGFSV 240 + SIL + +LD S+C+ + L+P FDR+ + +VNPKT +FF C F F+V Sbjct: 63 IPSILTSKTLDSSKCKSILPHLTPHHFDRLFLSLHRTVNPKTTHEFFRFATRHCNFRFTV 122 Query: 241 RSYCVLMRLLVASDMI 288 RSYC+L+R L+A + Sbjct: 123 RSYCLLLRSLLADSFV 138 >ref|XP_004149000.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Cucumis sativus] Length = 822 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/77 (42%), Positives = 45/77 (58%) Frame = +1 Query: 58 WVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAESCGFGFS 237 WV+S+L + SLD S+C + LSP FD++ I NP T L FFY + S F F+ Sbjct: 49 WVSSVLSHSSLDSSKCSALLPHLSPSQFDQLFFSIGLKANPMTCLNFFYFASNSFKFRFT 108 Query: 238 VRSYCVLMRLLVASDMI 288 + SYC L+ LL+ S I Sbjct: 109 IHSYCTLILLLIRSKFI 125 >gb|ESW28323.1| hypothetical protein PHAVU_003G277400g [Phaseolus vulgaris] Length = 837 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/87 (36%), Positives = 51/87 (58%) Frame = +1 Query: 28 PEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYV 207 P+ + +++ + S+L LD S+C+ + LSP FDR+ I +VNP T L FF + Sbjct: 54 PQTTNHALLTLLPSLLTTGVLDSSKCKSILPHLSPLEFDRLFFPIHHTVNPITTLDFFRL 113 Query: 208 GAESCGFGFSVRSYCVLMRLLVASDMI 288 F F+ RSYC+L+R L+AS ++ Sbjct: 114 ATNRFKFPFTFRSYCLLLRSLLASSLL 140 >gb|AHB18408.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum] Length = 846 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/91 (36%), Positives = 55/91 (60%) Frame = +1 Query: 10 ETRANQPEVFDQSVVKWVTSILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTA 189 + + + P +QS++ ++SIL PSLD S+ +Q+ LSP FDR + +PKT Sbjct: 66 QRQPSSPPPVNQSLLDTLSSILSKPSLDSSKSKQLLPLLSPSDFDRFFIALSPRADPKTT 125 Query: 190 LKFFYVGAESCGFGFSVRSYCVLMRLLVASD 282 L FF++ + F F++RSY +L+ LL+ S+ Sbjct: 126 LNFFHLASRCFNFRFTLRSYYILILLLLLSN 156 >ref|XP_004509525.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Cicer arietinum] gi|502153968|ref|XP_004509526.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X2 [Cicer arietinum] gi|502153970|ref|XP_004509527.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X3 [Cicer arietinum] gi|502153972|ref|XP_004509528.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X4 [Cicer arietinum] gi|502153974|ref|XP_004509529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X5 [Cicer arietinum] gi|502153976|ref|XP_004509530.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X6 [Cicer arietinum] gi|502153978|ref|XP_004509531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X7 [Cicer arietinum] gi|502153980|ref|XP_004509532.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X8 [Cicer arietinum] gi|502153982|ref|XP_004509533.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X9 [Cicer arietinum] gi|502153984|ref|XP_004509534.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X10 [Cicer arietinum] Length = 835 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = +1 Query: 67 SILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAESCGFGFSVRS 246 SIL + LD S+C+ + L+P FD + S+VN KT L FF + F F+VRS Sbjct: 62 SILSHKILDSSKCKSILPHLTPHQFDTLFFTHHSTVNLKTTLDFFRFASNQFKFCFTVRS 121 Query: 247 YCVLMRLLVASD 282 YC+L+RLL+ S+ Sbjct: 122 YCLLIRLLLCSN 133 >ref|XP_003628993.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523015|gb|AET03469.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 819 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/74 (41%), Positives = 47/74 (63%) Frame = +1 Query: 67 SILVNPSLDPSQCRQVFHRLSPPMFDRILCDIQSSVNPKTALKFFYVGAESCGFGFSVRS 246 SIL + LD S+C+ + L+P F+ ++VN KT L FF +++ F F+VRS Sbjct: 54 SILAHKVLDSSKCKTLIPNLTPHEFEHSFFTHHTTVNLKTTLDFFSFASKNFKFRFTVRS 113 Query: 247 YCVLMRLLVASDMI 288 YC+L+RLL+AS+ I Sbjct: 114 YCILIRLLLASNHI 127