BLASTX nr result
ID: Rheum21_contig00013079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00013079 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006360427.1| PREDICTED: ATP synthase subunit beta, mitoch... 71 1e-10 ref|XP_004236964.1| PREDICTED: ATP synthase subunit beta, mitoch... 71 1e-10 gb|AAD03392.1| mitochondrial ATPase beta subunit [Nicotiana sylv... 71 1e-10 gb|AAD03391.1| mitochondrial ATPase beta subunit [Nicotiana sylv... 71 1e-10 gb|AAD03393.1| ATPase beta subunit [Nicotiana sylvestris] 71 1e-10 sp|P17614.1|ATPBM_NICPL RecName: Full=ATP synthase subunit beta,... 71 1e-10 ref|XP_003592582.1| ATP synthase subunit beta [Medicago truncatu... 70 3e-10 gb|EXB65596.1| ATP synthase subunit beta [Morus notabilis] 70 4e-10 dbj|BAA20135.1| F1 ATPase [Pisum sativum] 70 4e-10 ref|NP_680155.1| ATP synthase subunit beta-3 [Arabidopsis thalia... 70 4e-10 ref|NP_568204.1| ATP synthase subunit beta-2 [Arabidopsis thalia... 70 4e-10 ref|XP_006344203.1| PREDICTED: ATP synthase subunit beta, mitoch... 70 4e-10 gb|ESW14989.1| hypothetical protein PHAVU_007G034800g [Phaseolus... 70 4e-10 ref|XP_004238867.1| PREDICTED: ATP synthase subunit beta, mitoch... 70 4e-10 ref|XP_002871356.1| ATP synthase beta chain 1, mitochondrial [Ar... 70 4e-10 emb|CAC81058.1| mitochondrial F1 ATP synthase beta subunit [Arab... 70 4e-10 ref|XP_002871355.1| hypothetical protein ARALYDRAFT_487710 [Arab... 70 4e-10 emb|CBI26938.3| unnamed protein product [Vitis vinifera] 70 4e-10 emb|CBI15526.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002280824.1| PREDICTED: ATP synthase subunit beta, mitoch... 70 4e-10 >ref|XP_006360427.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Solanum tuberosum] Length = 562 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIA+ESAA Sbjct: 527 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIAKESAA 562 >ref|XP_004236964.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Solanum lycopersicum] Length = 562 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIA+ESAA Sbjct: 527 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIAKESAA 562 >gb|AAD03392.1| mitochondrial ATPase beta subunit [Nicotiana sylvestris] Length = 556 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIA+ESAA Sbjct: 521 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIAKESAA 556 >gb|AAD03391.1| mitochondrial ATPase beta subunit [Nicotiana sylvestris] Length = 561 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIA+ESAA Sbjct: 526 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIAKESAA 561 >gb|AAD03393.1| ATPase beta subunit [Nicotiana sylvestris] Length = 555 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIA+ESAA Sbjct: 520 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIAKESAA 555 >sp|P17614.1|ATPBM_NICPL RecName: Full=ATP synthase subunit beta, mitochondrial; Flags: Precursor gi|19685|emb|CAA26620.1| ATP synthase beta subunit [Nicotiana plumbaginifolia] Length = 560 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIA+ESAA Sbjct: 525 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIAKESAA 560 >ref|XP_003592582.1| ATP synthase subunit beta [Medicago truncatula] gi|355481630|gb|AES62833.1| ATP synthase subunit beta [Medicago truncatula] Length = 1127 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQ+FYMVGGIDEVIAKAEKIA+ESAA Sbjct: 1089 VLDGKYDDLSEQAFYMVGGIDEVIAKAEKIAKESAA 1124 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESA 105 VLDGKYDDLSEQ+FYMVGGIDEVIAKAEKIA+E+A Sbjct: 524 VLDGKYDDLSEQAFYMVGGIDEVIAKAEKIAKENA 558 >gb|EXB65596.1| ATP synthase subunit beta [Morus notabilis] Length = 555 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 520 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 555 >dbj|BAA20135.1| F1 ATPase [Pisum sativum] Length = 561 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 523 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 558 >ref|NP_680155.1| ATP synthase subunit beta-3 [Arabidopsis thaliana] gi|75333362|sp|Q9C5A9.1|ATPBO_ARATH RecName: Full=ATP synthase subunit beta-3, mitochondrial; Flags: Precursor gi|13548326|emb|CAC35873.1| H+-transporting ATP synthase beta chain (mitochondrial)-like protein [Arabidopsis thaliana] gi|26450906|dbj|BAC42560.1| putative H+-transporting ATP synthase beta chain (mitochondrial) [Arabidopsis thaliana] gi|29028952|gb|AAO64855.1| At5g08680 [Arabidopsis thaliana] gi|332003954|gb|AED91337.1| ATP synthase subunit beta-3 [Arabidopsis thaliana] Length = 559 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 +LDGKYDDLSEQSFYMVGGIDEV+AKAEKIA+ESAA Sbjct: 524 LLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 559 >ref|NP_568204.1| ATP synthase subunit beta-2 [Arabidopsis thaliana] gi|26391492|sp|P83484.1|ATPBN_ARATH RecName: Full=ATP synthase subunit beta-2, mitochondrial; Flags: Precursor gi|13548327|emb|CAC35874.1| H+-transporting ATP synthase beta chain (mitochondrial)-like protein [Arabidopsis thaliana] gi|15293123|gb|AAK93672.1| unknown protein [Arabidopsis thaliana] gi|19310683|gb|AAL85072.1| unknown protein [Arabidopsis thaliana] gi|21281109|gb|AAM44896.1| unknown protein [Arabidopsis thaliana] gi|26452188|dbj|BAC43182.1| putative H+-transporting ATP synthase beta chain (mitochondrial) [Arabidopsis thaliana] gi|332003955|gb|AED91338.1| ATP synthase subunit beta-2 [Arabidopsis thaliana] Length = 556 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 +LDGKYDDLSEQSFYMVGGIDEV+AKAEKIA+ESAA Sbjct: 521 LLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 556 >ref|XP_006344203.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Solanum tuberosum] Length = 556 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 521 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 556 >gb|ESW14989.1| hypothetical protein PHAVU_007G034800g [Phaseolus vulgaris] Length = 558 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 522 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 557 >ref|XP_004238867.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Solanum lycopersicum] Length = 557 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 522 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 557 >ref|XP_002871356.1| ATP synthase beta chain 1, mitochondrial [Arabidopsis lyrata subsp. lyrata] gi|297810985|ref|XP_002873376.1| ATP synthase beta chain 1, mitochondrial [Arabidopsis lyrata subsp. lyrata] gi|26391487|sp|P83483.1|ATPBM_ARATH RecName: Full=ATP synthase subunit beta-1, mitochondrial; Flags: Precursor gi|13548325|emb|CAC35872.1| H+-transporting ATP synthase beta chain (mitochondrial)-like protein [Arabidopsis thaliana] gi|15809909|gb|AAL06882.1| At5g08670 [Arabidopsis thaliana] gi|19347814|gb|AAL86357.1| unknown protein [Arabidopsis thaliana] gi|21360569|gb|AAM47481.1| At5g08670/At5g08670 [Arabidopsis thaliana] gi|21436349|gb|AAM51344.1| unknown protein [Arabidopsis thaliana] gi|26452103|dbj|BAC43141.1| putative H+-transporting ATP synthase beta chain (mitochondrial) [Arabidopsis thaliana] gi|297317193|gb|EFH47615.1| ATP synthase beta chain 1, mitochondrial [Arabidopsis lyrata subsp. lyrata] gi|297319213|gb|EFH49635.1| ATP synthase beta chain 1, mitochondrial [Arabidopsis lyrata subsp. lyrata] Length = 556 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 +LDGKYDDLSEQSFYMVGGIDEV+AKAEKIA+ESAA Sbjct: 521 LLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 556 >emb|CAC81058.1| mitochondrial F1 ATP synthase beta subunit [Arabidopsis thaliana] Length = 589 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 +LDGKYDDLSEQSFYMVGGIDEV+AKAEKIA+ESAA Sbjct: 554 LLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 589 >ref|XP_002871355.1| hypothetical protein ARALYDRAFT_487710 [Arabidopsis lyrata subsp. lyrata] gi|297317192|gb|EFH47614.1| hypothetical protein ARALYDRAFT_487710 [Arabidopsis lyrata subsp. lyrata] Length = 559 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 +LDGKYDDLSEQSFYMVGGIDEV+AKAEKIA+ESAA Sbjct: 524 LLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 559 >emb|CBI26938.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 384 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 419 >emb|CBI15526.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 384 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 419 >ref|XP_002280824.1| PREDICTED: ATP synthase subunit beta, mitochondrial-like [Vitis vinifera] Length = 554 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 1 VLDGKYDDLSEQSFYMVGGIDEVIAKAEKIARESAA 108 VLDGKYDDLSEQSFYMVGGI+EVIAKAEKIA+ESAA Sbjct: 519 VLDGKYDDLSEQSFYMVGGIEEVIAKAEKIAKESAA 554