BLASTX nr result
ID: Rheum21_contig00012810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00012810 (200 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosph... 109 4e-22 gb|EOY06485.1| Mitochondrial substrate carrier family protein [T... 109 4e-22 ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosph... 109 4e-22 ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosph... 108 6e-22 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 107 2e-21 ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [A... 107 2e-21 ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosph... 107 2e-21 ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citr... 106 4e-21 ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citr... 106 4e-21 ref|XP_006419606.1| hypothetical protein CICLE_v10005390mg [Citr... 106 4e-21 ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citr... 106 4e-21 gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus pe... 105 5e-21 ref|NP_199708.1| mitochondrial substrate carrier family protein ... 102 4e-20 ref|XP_006389228.1| mitochondrial substrate carrier family prote... 102 4e-20 ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Popu... 102 4e-20 ref|XP_002330367.1| predicted protein [Populus trichocarpa] 102 4e-20 ref|XP_002865695.1| mitochondrial substrate carrier family prote... 102 5e-20 ref|XP_006395106.1| hypothetical protein EUTSA_v10004544mg [Eutr... 102 7e-20 gb|EXB74801.1| Mitochondrial thiamine pyrophosphate carrier [Mor... 101 9e-20 gb|EXB66507.1| Lysine-specific demethylase REF6 [Morus notabilis] 101 9e-20 >ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 331 Score = 109 bits (272), Expect = 4e-22 Identities = 49/66 (74%), Positives = 55/66 (83%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVRTDSISSLQLFLCGLAAGTSAKAVCHPLDV 180 PYAGLQFGTYDTFKRWM+ WN +RS + + +SS QLF+CGLAAGT AKAVCHPLDV Sbjct: 194 PYAGLQFGTYDTFKRWMMAWNHLRSSNAIHGDEQVSSFQLFICGLAAGTCAKAVCHPLDV 253 Query: 181 VKKRFQ 198 VKKRFQ Sbjct: 254 VKKRFQ 259 >gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 330 Score = 109 bits (272), Expect = 4e-22 Identities = 51/67 (76%), Positives = 56/67 (83%), Gaps = 1/67 (1%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLS-VRTDSISSLQLFLCGLAAGTSAKAVCHPLD 177 PYAGLQFGTYDTFKRW + WNR+RS + S DS+SS QLF+CGLAAGT AK VCHPLD Sbjct: 192 PYAGLQFGTYDTFKRWTMSWNRLRSSNTSSTMDDSLSSFQLFICGLAAGTCAKLVCHPLD 251 Query: 178 VVKKRFQ 198 VVKKRFQ Sbjct: 252 VVKKRFQ 258 >ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum lycopersicum] Length = 331 Score = 109 bits (272), Expect = 4e-22 Identities = 49/66 (74%), Positives = 55/66 (83%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVRTDSISSLQLFLCGLAAGTSAKAVCHPLDV 180 PYAGLQFGTYDTFKRWM+ WN +RS + + +SS QLF+CGLAAGT AKAVCHPLDV Sbjct: 194 PYAGLQFGTYDTFKRWMMAWNHLRSSNAIHGDEQVSSFQLFICGLAAGTCAKAVCHPLDV 253 Query: 181 VKKRFQ 198 VKKRFQ Sbjct: 254 VKKRFQ 259 >ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 329 Score = 108 bits (271), Expect = 6e-22 Identities = 50/66 (75%), Positives = 55/66 (83%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVRTDSISSLQLFLCGLAAGTSAKAVCHPLDV 180 PYAGLQFGTYDTFKRWM WNR+RS + S + ISS QLF+CGL +GT AKAVCHPLDV Sbjct: 192 PYAGLQFGTYDTFKRWMKAWNRLRSSNSSQGDEFISSFQLFICGLGSGTCAKAVCHPLDV 251 Query: 181 VKKRFQ 198 VKKRFQ Sbjct: 252 VKKRFQ 257 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 107 bits (267), Expect = 2e-21 Identities = 51/67 (76%), Positives = 56/67 (83%), Gaps = 1/67 (1%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVR-TDSISSLQLFLCGLAAGTSAKAVCHPLD 177 PYAGLQFGTYD FKRW + WN+ RS + ++ TDSISS QLFLCG AAGT AKAVCHPLD Sbjct: 192 PYAGLQFGTYDMFKRWTMAWNQYRSSNANLTGTDSISSFQLFLCGFAAGTCAKAVCHPLD 251 Query: 178 VVKKRFQ 198 VVKKRFQ Sbjct: 252 VVKKRFQ 258 >ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] gi|548859284|gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 107 bits (266), Expect = 2e-21 Identities = 52/68 (76%), Positives = 55/68 (80%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIR--SPDLSVRTDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW WN +R P+ S DS+SS QLFLCGLAAGT AKAVCHPL Sbjct: 230 PYAGLQFGTYDTFKRWTKGWNHLRYGQPNGSPSDDSLSSFQLFLCGLAAGTCAKAVCHPL 289 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 290 DVVKKRFQ 297 >ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cicer arietinum] Length = 333 Score = 107 bits (266), Expect = 2e-21 Identities = 48/66 (72%), Positives = 54/66 (81%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVRTDSISSLQLFLCGLAAGTSAKAVCHPLDV 180 PYAGLQFGTYDTFKRW + WN ++S + +S+SS QLFLCGLAAGT AK VCHPLDV Sbjct: 196 PYAGLQFGTYDTFKRWAMAWNHVQSSTNTAAEESLSSFQLFLCGLAAGTCAKLVCHPLDV 255 Query: 181 VKKRFQ 198 VKKRFQ Sbjct: 256 VKKRFQ 261 >ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521481|gb|ESR32848.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 268 Score = 106 bits (264), Expect = 4e-21 Identities = 50/68 (73%), Positives = 57/68 (83%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVR--TDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW ++WNRIRS + S +++SS QLF+CGLAAGT AK VCHPL Sbjct: 129 PYAGLQFGTYDTFKRWTMDWNRIRSSNTSSTGADNNLSSFQLFVCGLAAGTCAKLVCHPL 188 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 189 DVVKKRFQ 196 >ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|568871878|ref|XP_006489106.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Citrus sinensis] gi|557521480|gb|ESR32847.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 333 Score = 106 bits (264), Expect = 4e-21 Identities = 50/68 (73%), Positives = 57/68 (83%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVR--TDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW ++WNRIRS + S +++SS QLF+CGLAAGT AK VCHPL Sbjct: 194 PYAGLQFGTYDTFKRWTMDWNRIRSSNTSSTGADNNLSSFQLFVCGLAAGTCAKLVCHPL 253 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 254 DVVKKRFQ 261 >ref|XP_006419606.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521479|gb|ESR32846.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 262 Score = 106 bits (264), Expect = 4e-21 Identities = 50/68 (73%), Positives = 57/68 (83%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVR--TDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW ++WNRIRS + S +++SS QLF+CGLAAGT AK VCHPL Sbjct: 194 PYAGLQFGTYDTFKRWTMDWNRIRSSNTSSTGADNNLSSFQLFVCGLAAGTCAKLVCHPL 253 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 254 DVVKKRFQ 261 >ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521478|gb|ESR32845.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 241 Score = 106 bits (264), Expect = 4e-21 Identities = 50/68 (73%), Positives = 57/68 (83%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVR--TDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW ++WNRIRS + S +++SS QLF+CGLAAGT AK VCHPL Sbjct: 102 PYAGLQFGTYDTFKRWTMDWNRIRSSNTSSTGADNNLSSFQLFVCGLAAGTCAKLVCHPL 161 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 162 DVVKKRFQ 169 >gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] Length = 331 Score = 105 bits (263), Expect = 5e-21 Identities = 51/68 (75%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPD--LSVRTDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW + WN RS + L R D +SS QLFLCGLAAGT AK VCHPL Sbjct: 192 PYAGLQFGTYDTFKRWTMTWNLYRSSNTNLQSREDGLSSFQLFLCGLAAGTCAKLVCHPL 251 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 252 DVVKKRFQ 259 >ref|NP_199708.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] gi|10177187|dbj|BAB10321.1| mitochondrial carrier protein-like [Arabidopsis thaliana] gi|26449838|dbj|BAC42042.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|30017309|gb|AAP12888.1| At5g48970 [Arabidopsis thaliana] gi|332008368|gb|AED95751.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] Length = 339 Score = 102 bits (255), Expect = 4e-20 Identities = 48/68 (70%), Positives = 56/68 (82%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIR-SPDLSVRTDS-ISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYD FKRWM++WNR + S + + D+ +SS QLF+CGL AGTSAK VCHPL Sbjct: 200 PYAGLQFGTYDMFKRWMMDWNRYKLSSKIPINVDTNLSSFQLFICGLGAGTSAKLVCHPL 259 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 260 DVVKKRFQ 267 >ref|XP_006389228.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550311967|gb|ERP48142.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 342 Score = 102 bits (255), Expect = 4e-20 Identities = 50/68 (73%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVRT--DSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW + WN RS S + DS+SS QLF+CGLAAGT AK VCHPL Sbjct: 203 PYAGLQFGTYDTFKRWTMGWNHDRSSTTSFISTDDSLSSFQLFVCGLAAGTCAKLVCHPL 262 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 263 DVVKKRFQ 270 >ref|XP_006389227.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] gi|550311966|gb|ERP48141.1| hypothetical protein POPTR_0034s00220g [Populus trichocarpa] Length = 305 Score = 102 bits (255), Expect = 4e-20 Identities = 50/68 (73%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVRT--DSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW + WN RS S + DS+SS QLF+CGLAAGT AK VCHPL Sbjct: 166 PYAGLQFGTYDTFKRWTMGWNHDRSSTTSFISTDDSLSSFQLFVCGLAAGTCAKLVCHPL 225 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 226 DVVKKRFQ 233 >ref|XP_002330367.1| predicted protein [Populus trichocarpa] Length = 329 Score = 102 bits (255), Expect = 4e-20 Identities = 50/68 (73%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIRSPDLSVRT--DSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW + WN RS S + DS+SS QLF+CGLAAGT AK VCHPL Sbjct: 191 PYAGLQFGTYDTFKRWTMGWNHDRSSTTSFISTDDSLSSFQLFVCGLAAGTCAKLVCHPL 250 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 251 DVVKKRFQ 258 >ref|XP_002865695.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297311530|gb|EFH41954.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 338 Score = 102 bits (254), Expect = 5e-20 Identities = 50/68 (73%), Positives = 56/68 (82%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNR-IRSPDLSVRTDS-ISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYD FKRWM++WNR I S + D+ +SSLQLF+CGL AGTSAK VCHPL Sbjct: 199 PYAGLQFGTYDMFKRWMMDWNRYILSSKNPINVDTNLSSLQLFVCGLGAGTSAKLVCHPL 258 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 259 DVVKKRFQ 266 >ref|XP_006395106.1| hypothetical protein EUTSA_v10004544mg [Eutrema salsugineum] gi|557091745|gb|ESQ32392.1| hypothetical protein EUTSA_v10004544mg [Eutrema salsugineum] Length = 337 Score = 102 bits (253), Expect = 7e-20 Identities = 51/68 (75%), Positives = 55/68 (80%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNR-IRSPDLSVRTDS-ISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYD FKRWM++WNR I S V D+ ISS QLF+CGL AGTSAK VCHPL Sbjct: 198 PYAGLQFGTYDMFKRWMMDWNRYILSSKNPVNVDTNISSFQLFVCGLGAGTSAKLVCHPL 257 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 258 DVVKKRFQ 265 >gb|EXB74801.1| Mitochondrial thiamine pyrophosphate carrier [Morus notabilis] Length = 331 Score = 101 bits (252), Expect = 9e-20 Identities = 51/68 (75%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIR-SPDLSVR-TDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW L WNR + S S+ D +SS QLFLCGLAAGT AK VCHPL Sbjct: 192 PYAGLQFGTYDTFKRWTLAWNRSQLSKTNSINGDDGVSSFQLFLCGLAAGTCAKLVCHPL 251 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 252 DVVKKRFQ 259 >gb|EXB66507.1| Lysine-specific demethylase REF6 [Morus notabilis] Length = 1195 Score = 101 bits (252), Expect = 9e-20 Identities = 51/68 (75%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 1 PYAGLQFGTYDTFKRWMLEWNRIR-SPDLSVR-TDSISSLQLFLCGLAAGTSAKAVCHPL 174 PYAGLQFGTYDTFKRW L WNR + S S+ D +SS QLFLCGLAAGT AK VCHPL Sbjct: 129 PYAGLQFGTYDTFKRWTLAWNRSQLSKTNSINGDDGVSSFQLFLCGLAAGTCAKLVCHPL 188 Query: 175 DVVKKRFQ 198 DVVKKRFQ Sbjct: 189 DVVKKRFQ 196