BLASTX nr result
ID: Rheum21_contig00010741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00010741 (224 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596153.1| hypothetical protein MTR_2g068900 [Medicago ... 57 3e-06 >ref|XP_003596153.1| hypothetical protein MTR_2g068900 [Medicago truncatula] gi|355485201|gb|AES66404.1| hypothetical protein MTR_2g068900 [Medicago truncatula] Length = 138 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 2/70 (2%) Frame = +2 Query: 11 LHNKPLEPGYMKVTIIDPKVQDAPLPMPTDEA--YTVFEAVGAFVAWPTNLVFRNTMELQ 184 LH+KPL GY+KV+I QDA LP+P D A V +A+G +VAW NLV N LQ Sbjct: 21 LHHKPLPDGYLKVSIDIALEQDAVLPIPDDVADIRLVRDAIGTYVAWQRNLVSLNLQILQ 80 Query: 185 LPSGGKDKGL 214 P+ K + L Sbjct: 81 KPNSTKCRPL 90