BLASTX nr result
ID: Rheum21_contig00010710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00010710 (237 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524548.1| suppressor of ty, putative [Ricinus communis... 60 3e-07 ref|XP_002322597.2| hypothetical protein POPTR_0016s02900g [Popu... 59 7e-07 ref|XP_002322598.1| predicted protein [Populus trichocarpa] 59 7e-07 ref|XP_004493316.1| PREDICTED: transcription elongation factor S... 55 7e-06 ref|XP_004493315.1| PREDICTED: transcription elongation factor S... 55 7e-06 ref|XP_004493314.1| PREDICTED: transcription elongation factor S... 55 7e-06 ref|XP_002278416.2| PREDICTED: transcription elongation factor S... 55 7e-06 emb|CBI32841.3| unnamed protein product [Vitis vinifera] 55 7e-06 >ref|XP_002524548.1| suppressor of ty, putative [Ricinus communis] gi|223536178|gb|EEF37832.1| suppressor of ty, putative [Ricinus communis] Length = 1650 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGY-NSRQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 D+Q+SGY NS+ S +KD D GWGSFPG+KV+NSPGREAFP Sbjct: 1540 DKQESGYDNSKWDSVAKDSD--AGWGSFPGAKVQNSPGREAFP 1580 >ref|XP_002322597.2| hypothetical protein POPTR_0016s02900g [Populus trichocarpa] gi|550320692|gb|EEF04358.2| hypothetical protein POPTR_0016s02900g [Populus trichocarpa] Length = 1692 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGYNS-RQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 +RQDSGY+ R S +KD D GWGSFPG+KV+NSPGREAFP Sbjct: 1519 ERQDSGYDKPRWDSGTKDNDE--GWGSFPGAKVQNSPGREAFP 1559 >ref|XP_002322598.1| predicted protein [Populus trichocarpa] Length = 287 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGYNS-RQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 +RQDSGY+ R S +KD D GWGSFPG+KV+NSPGREAFP Sbjct: 114 ERQDSGYDKPRWDSGTKDNDE--GWGSFPGAKVQNSPGREAFP 154 >ref|XP_004493316.1| PREDICTED: transcription elongation factor SPT6-like isoform X3 [Cicer arietinum] Length = 1451 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGYNS-RQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 +RQDSGY + R GS KDGD+ G +FPG+KV+NSPGREAFP Sbjct: 1356 ERQDSGYGTTRWGSAPKDGDD--GLSNFPGAKVQNSPGREAFP 1396 >ref|XP_004493315.1| PREDICTED: transcription elongation factor SPT6-like isoform X2 [Cicer arietinum] Length = 1641 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGYNS-RQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 +RQDSGY + R GS KDGD+ G +FPG+KV+NSPGREAFP Sbjct: 1546 ERQDSGYGTTRWGSAPKDGDD--GLSNFPGAKVQNSPGREAFP 1586 >ref|XP_004493314.1| PREDICTED: transcription elongation factor SPT6-like isoform X1 [Cicer arietinum] Length = 1639 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGYNS-RQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 +RQDSGY + R GS KDGD+ G +FPG+KV+NSPGREAFP Sbjct: 1544 ERQDSGYGTTRWGSAPKDGDD--GLSNFPGAKVQNSPGREAFP 1584 >ref|XP_002278416.2| PREDICTED: transcription elongation factor SPT6-like [Vitis vinifera] Length = 1660 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGYNS-RQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 +RQDSGY + + S SKDG++ GW SFPG+KV+NSPG+E+FP Sbjct: 1538 ERQDSGYGTPKWDSGSKDGED--GWNSFPGAKVQNSPGKESFP 1578 >emb|CBI32841.3| unnamed protein product [Vitis vinifera] Length = 1646 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 154 DRQDSGYNS-RQGSQSKDGDNSGGWGSFPGSKVENSPGREAFP 29 +RQDSGY + + S SKDG++ GW SFPG+KV+NSPG+E+FP Sbjct: 1524 ERQDSGYGTPKWDSGSKDGED--GWNSFPGAKVQNSPGKESFP 1564