BLASTX nr result
ID: Rheum21_contig00010410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00010410 (506 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 77 3e-12 gb|EMJ02097.1| hypothetical protein PRUPE_ppb017528mg [Prunus pe... 76 5e-12 gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus... 70 3e-10 gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus... 70 4e-10 ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659... 69 5e-10 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gi|222861166|gb|EEE98708.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +1 Query: 94 KMGAVPSSIRSLKMRSWQRCSKHIREQRARLYLIWRCTVILVCWQD 231 +M A S+RS+K+RSWQRCSK IREQR RLY+IWRCTV+L+CW D Sbjct: 19 QMAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >gb|EMJ02097.1| hypothetical protein PRUPE_ppb017528mg [Prunus persica] Length = 67 Score = 75.9 bits (185), Expect = 5e-12 Identities = 30/49 (61%), Positives = 40/49 (81%) Frame = +1 Query: 85 LGKKMGAVPSSIRSLKMRSWQRCSKHIREQRARLYLIWRCTVILVCWQD 231 +G A+P++ SLK+R W RCSKHIREQRARLY++WRC+V+L+CW D Sbjct: 19 MGMAAMAIPTTRSSLKLRPWTRCSKHIREQRARLYIVWRCSVMLLCWHD 67 >gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] Length = 70 Score = 70.1 bits (170), Expect = 3e-10 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +1 Query: 103 AVPSSIRSLKMRSWQRCSKHIREQRARLYLIWRCTVILVCWQD 231 A+ SS+R+ K+R W RCSK+IR+QR RLY+IWRCTV+L+CW D Sbjct: 28 AMFSSLRASKLRPWGRCSKYIRQQRTRLYIIWRCTVLLLCWHD 70 >gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 69.7 bits (169), Expect = 4e-10 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +1 Query: 97 MGAVPSSIRSLKMRSWQRCSKHIREQRARLYLIWRCTVILVCWQD 231 M A S+R K+RSW+RCSK +R+QR RLY+IWRCTV+L+CW + Sbjct: 1 MAASVFSVRGSKIRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659834 [Glycine max] Length = 45 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +1 Query: 97 MGAVPSSIRSLKMRSWQRCSKHIREQRARLYLIWRCTVILVCWQD 231 M A S+R K+RSW+RCSK +R+QR RLY+IWRCTV+L+CW + Sbjct: 1 MAANVFSVRGSKVRSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 118 IRSLKMRSWQRCSKHIREQRARLYLIWRCTVILVCWQD 231 IR K RSWQRCS+ ++EQR RLY+IWRCTVIL+ W D Sbjct: 9 IRFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46