BLASTX nr result
ID: Rheum21_contig00008429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00008429 (291 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20340.1| hypothetical protein L484_020561 [Morus notabilis] 55 9e-06 >gb|EXC20340.1| hypothetical protein L484_020561 [Morus notabilis] Length = 112 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 182 MRFSEKLQVEGGLESELRKWVIAGIGFRSKLRPVNT 289 M FS+K Q++GGLESE RKWVIAGI RS L+P+NT Sbjct: 1 MGFSKKSQIDGGLESEGRKWVIAGISVRSSLKPINT 36