BLASTX nr result
ID: Rheum21_contig00003643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00003643 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20729.3| unnamed protein product [Vitis vinifera] 55 1e-05 ref|XP_002281615.1| PREDICTED: myosin-H heavy chain-like [Vitis ... 55 1e-05 emb|CAN64315.1| hypothetical protein VITISV_036695 [Vitis vinifera] 55 1e-05 >emb|CBI20729.3| unnamed protein product [Vitis vinifera] Length = 1524 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 206 MSLRKGANVWVEDKDLAWVPAEVLDIVGSQVEV 304 MSLRKG+ VWVED++LAWV AEV+D VG QV+V Sbjct: 1 MSLRKGSKVWVEDRELAWVAAEVVDFVGKQVQV 33 >ref|XP_002281615.1| PREDICTED: myosin-H heavy chain-like [Vitis vinifera] Length = 1517 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 206 MSLRKGANVWVEDKDLAWVPAEVLDIVGSQVEV 304 MSLRKG+ VWVED++LAWV AEV+D VG QV+V Sbjct: 1 MSLRKGSKVWVEDRELAWVAAEVVDFVGKQVQV 33 >emb|CAN64315.1| hypothetical protein VITISV_036695 [Vitis vinifera] Length = 974 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 206 MSLRKGANVWVEDKDLAWVPAEVLDIVGSQVEV 304 MSLRKG+ VWVED++LAWV AEV+D VG QV+V Sbjct: 1 MSLRKGSKVWVEDRELAWVAAEVVDFVGKQVQV 33