BLASTX nr result
ID: Rheum21_contig00003630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00003630 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX96434.1| Mitochondrial transcription termination factor fa... 59 5e-07 >gb|EOX96434.1| Mitochondrial transcription termination factor family protein, putative [Theobroma cacao] Length = 560 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +2 Query: 101 HLLPAFSSAILRRHFSSKPKLPSLCNVPSKHRHRAFEQAQSVIVDYLHATR 253 HL F + L RHFS+ PKLPSL +PSK+R +A + AQ + DYLH TR Sbjct: 2 HLFSKFLYSHLSRHFSTLPKLPSLTKIPSKYRPQAIQDAQQALTDYLHGTR 52