BLASTX nr result
ID: Rheum21_contig00002913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00002913 (575 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_566509.1| metallothionein 3 [Arabidopsis thaliana] gi|233... 67 4e-09 dbj|BAB85601.1| metallothionein type 3 [Brassica juncea] 65 1e-08 ref|XP_002885083.1| hypothetical protein ARALYDRAFT_897819 [Arab... 65 1e-08 gb|AAQ62903.1| MT-like protein [Fagopyrum esculentum] 62 1e-07 ref|XP_006406981.1| hypothetical protein EUTSA_v10021853mg [Eutr... 61 2e-07 gb|AAM19713.1|AF499726_1 metallothionein-like protein [Eutrema h... 61 2e-07 ref|XP_006298919.1| hypothetical protein CARUB_v10015040mg [Caps... 60 3e-07 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 60 5e-07 gb|ABG75913.1| metallothionein [Fagopyrum esculentum] 60 5e-07 gb|AFP57435.1| putative metallothionein type 3 [Brassica napus] 59 7e-07 gb|AAC13291.1| metallothionein-like protein [Fagopyrum esculentum] 59 1e-06 gb|ACR46965.1| metallothionein 3 [Noccaea caerulescens] gi|23861... 59 1e-06 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 gb|ABG75912.1| metallothionein [Fagopyrum esculentum] 58 2e-06 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 57 3e-06 dbj|BAB85600.1| metallothionein type 3 [Brassica juncea] 57 4e-06 ref|NP_001189899.1| metallothionein 3 [Arabidopsis thaliana] gi|... 57 4e-06 gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 57 4e-06 emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] 56 6e-06 dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] 55 1e-05 >ref|NP_566509.1| metallothionein 3 [Arabidopsis thaliana] gi|2338712|gb|AAB67234.1| metallothionein-like protein [Arabidopsis thaliana] gi|9294268|dbj|BAB02170.1| metallothionein-like protein [Arabidopsis thaliana] gi|18377773|gb|AAL67036.1| unknown protein [Arabidopsis thaliana] gi|20259219|gb|AAM14325.1| unknown protein [Arabidopsis thaliana] gi|21592819|gb|AAM64769.1| metallothionein-like protein [Arabidopsis thaliana] gi|110738955|dbj|BAF01398.1| hypothetical protein [Arabidopsis thaliana] gi|332642134|gb|AEE75655.1| metallothionein 3 [Arabidopsis thaliana] Length = 69 Score = 66.6 bits (161), Expect = 4e-09 Identities = 28/46 (60%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MS NCGSC+C+DK+ CVK G+ Y+FDI+ET + Y +AM+MDV A E Sbjct: 1 MSSNCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMIMDVGAEE 46 >dbj|BAB85601.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/46 (60%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MSD CGSC+C+DK+ CVK G+ Y+FDI+ET + Y +AM MDV A E Sbjct: 1 MSDKCGSCDCADKTQCVKKGTSYTFDIVETQESYKEAMFMDVGAEE 46 >ref|XP_002885083.1| hypothetical protein ARALYDRAFT_897819 [Arabidopsis lyrata subsp. lyrata] gi|297330923|gb|EFH61342.1| hypothetical protein ARALYDRAFT_897819 [Arabidopsis lyrata subsp. lyrata] Length = 69 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/46 (58%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MS NCGSC+C+DK+ CVK G+ Y+FDI++T + Y +AM+MDV A E Sbjct: 1 MSSNCGSCDCADKTQCVKKGTSYTFDIVKTQESYKEAMIMDVGAEE 46 >gb|AAQ62903.1| MT-like protein [Fagopyrum esculentum] Length = 49 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETNDYVDAMVMDVSASE 254 MS NCGSC+CSDKS C K G Y+FDI+ET+++VD MVM+ S ++ Sbjct: 1 MSSNCGSCDCSDKSQCGKKG--YTFDIVETDNFVDTMVMNASEND 43 >ref|XP_006406981.1| hypothetical protein EUTSA_v10021853mg [Eutrema salsugineum] gi|557108127|gb|ESQ48434.1| hypothetical protein EUTSA_v10021853mg [Eutrema salsugineum] Length = 86 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MSD CG+C+C+DK+ CVK + Y+FDI+ET + Y +AM MDV A E Sbjct: 18 MSDKCGTCDCADKTQCVKKRTSYTFDIVETQESYKEAMFMDVGAEE 63 >gb|AAM19713.1|AF499726_1 metallothionein-like protein [Eutrema halophilum] Length = 69 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MSD CG+C+C+DK+ CVK + Y+FDI+ET + Y +AM MDV A E Sbjct: 1 MSDKCGTCDCADKTQCVKKRTSYTFDIVETQESYKEAMFMDVGAEE 46 >ref|XP_006298919.1| hypothetical protein CARUB_v10015040mg [Capsella rubella] gi|482567628|gb|EOA31817.1| hypothetical protein CARUB_v10015040mg [Capsella rubella] Length = 69 Score = 60.5 bits (145), Expect = 3e-07 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MS+NCGSC+C+DK+ C K G+ Y DI+ET + Y +AM+MDV A E Sbjct: 1 MSNNCGSCDCADKTQCGKKGTSYIVDIVETQESYKEAMIMDVGAEE 46 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 59.7 bits (143), Expect = 5e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETNDYVDAMVMDVSASE 254 MSD CG+C+C+DK+ CVK GS Y+ DIIET + +VMD A+E Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAAE 45 >gb|ABG75913.1| metallothionein [Fagopyrum esculentum] Length = 62 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETNDYVDAMVMDVSASE 254 MS NCGSC+C DKS C K G Y+FDI+ET+++VD MVM+ S ++ Sbjct: 1 MSSNCGSCDCFDKSQCGKKG--YTFDIVETDNFVDTMVMNASEND 43 >gb|AFP57435.1| putative metallothionein type 3 [Brassica napus] Length = 67 Score = 59.3 bits (142), Expect = 7e-07 Identities = 23/43 (53%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = +3 Query: 129 NCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 +CG+C+C+DK+ CVK G+ Y+FDI+ET + Y +AM+MDV+ +E Sbjct: 3 SCGNCDCADKTQCVKKGTSYTFDIVETKESYKEAMIMDVNGAE 45 >gb|AAC13291.1| metallothionein-like protein [Fagopyrum esculentum] Length = 59 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETNDYVDAMVMDVSASE 254 MS NCG+C+CSDK+ C K G Y+FDI+ET++++D MVM+ S ++ Sbjct: 1 MSSNCGTCDCSDKTQCGKKG--YTFDIVETDNFLDTMVMNASEND 43 >gb|ACR46965.1| metallothionein 3 [Noccaea caerulescens] gi|238617695|gb|ACR46969.1| metallothionein 3 [Noccaea caerulescens] Length = 67 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/46 (54%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MSD CGSC+C+DK+ CVK + Y+ D++ET + Y +AM MDV A E Sbjct: 1 MSDKCGSCDCADKTQCVKKSTSYTLDMVETQESYKEAMNMDVGAEE 46 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/46 (54%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIET-NDYVDAMVMDVSASE 254 MS CG+C+C+DKS CVK GS Y+ DI+ET +V ++MDV A+E Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAE 46 >gb|ABG75912.1| metallothionein [Fagopyrum esculentum] Length = 62 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETNDYVDAMVMDVSASE 254 MS NCGSC+CSDKS C K G Y+FDI+E +++ D MVM+ S ++ Sbjct: 1 MSSNCGSCDCSDKSQCGKKG--YTFDIVEIDNFADTMVMNASEND 43 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/46 (54%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIET-NDYVDAMVMDVSASE 254 MS CG+C+C+DKS CVK GS Y+ DI+ET +V +VM+V A+E Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPATE 46 >dbj|BAB85600.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/42 (54%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +3 Query: 132 CGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 CG+C+C+DK+ CVK + Y+FDI+ET + Y +AM+MDVS +E Sbjct: 4 CGNCDCADKTQCVKKVTSYTFDIVETQESYKEAMIMDVSGAE 45 >ref|NP_001189899.1| metallothionein 3 [Arabidopsis thaliana] gi|332642135|gb|AEE75656.1| metallothionein 3 [Arabidopsis thaliana] Length = 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 MS NCGSC+C+DK+ K G+ Y+FDI+ET + Y +AM+MDV A E Sbjct: 1 MSSNCGSCDCADKTQ--KKGTSYTFDIVETQESYKEAMIMDVGAEE 44 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +3 Query: 120 MSDNCGSCNCSDKSHCVKNGSQYSFDIIET-NDYVDAMVMDVSA 248 MS CG+C+C+DKS CVK GS Y+ DI+ET +V +VMDV A Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPA 44 >emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] Length = 65 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/43 (55%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 129 NCGSCNCSDKSHCVKNGSQYSFDIIET-NDYVDAMVMDVSASE 254 +CG+C+C+DK++C K G+ Y FDIIET Y D +VMDV A+E Sbjct: 3 SCGNCDCADKTNCPKKGNSYGFDIIETQKSYDDVVVMDVQAAE 45 >dbj|BAB85599.1| metallothionein type 3 [Brassica juncea] Length = 67 Score = 55.5 bits (132), Expect = 1e-05 Identities = 21/43 (48%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +3 Query: 129 NCGSCNCSDKSHCVKNGSQYSFDIIETND-YVDAMVMDVSASE 254 +CG+C+C+DK+ CVK G+ Y+ DI+ET + Y +AM+M+V+ +E Sbjct: 3 SCGNCDCADKTQCVKKGTSYTLDIVETQESYKEAMIMEVNGAE 45