BLASTX nr result
ID: Rheum21_contig00001697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00001697 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer ... 67 2e-09 ref|XP_004500971.1| PREDICTED: thioredoxin H-type-like [Cicer ar... 66 6e-09 gb|ESW08033.1| hypothetical protein PHAVU_009G012800g [Phaseolus... 65 1e-08 pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 Fro... 64 2e-08 gb|ADN96593.1| thioredoxin h [Vitis vinifera] 64 2e-08 emb|CBI17430.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002274205.1| PREDICTED: thioredoxin H-type 2 [Vitis vinif... 64 2e-08 gb|AAZ98842.1| thioredoxin h1 [Medicago truncatula] 64 2e-08 ref|XP_002307687.1| thioredoxin h family protein [Populus tricho... 64 2e-08 gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] 64 3e-08 ref|XP_003527904.1| PREDICTED: thioredoxin H-type [Glycine max] 63 4e-08 ref|XP_003550402.1| PREDICTED: thioredoxin H-type [Glycine max] 63 4e-08 sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Shor... 63 5e-08 gb|AEI69284.1| thioredoxin h 1-2 [Galega orientalis] 63 5e-08 ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus commun... 63 5e-08 ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Caps... 62 6e-08 gb|AAZ32865.1| thioredoxin h [Medicago sativa] 62 6e-08 gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus pe... 62 8e-08 sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Shor... 62 8e-08 gb|AEC03323.1| thioredoxin H-type 8 [Hevea brasiliensis] 62 8e-08 >ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer arietinum] Length = 120 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHATMPV 129 EWS EAMPTF+FLK+GK V+KVVGA K+LLQ TI KHAT V Sbjct: 76 EWSVEAMPTFLFLKEGKKVDKVVGAKKELLQQTITKHATATV 117 >ref|XP_004500971.1| PREDICTED: thioredoxin H-type-like [Cicer arietinum] Length = 113 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHA 117 EW EAMPTF+FLK+GKLV+KVVGA K+ LQSTIAKHA Sbjct: 76 EWGVEAMPTFLFLKEGKLVDKVVGAQKEKLQSTIAKHA 113 >gb|ESW08033.1| hypothetical protein PHAVU_009G012800g [Phaseolus vulgaris] Length = 122 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 EW EAMPTF+FLK+GKLV+KVVGA KD LQ IAKHAT Sbjct: 75 EWKVEAMPTFLFLKEGKLVDKVVGAKKDELQLAIAKHAT 113 >pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 EW+ EAMPTFIFLKDGKLV+K VGA+KD L + +AKHAT Sbjct: 74 EWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHAT 112 >gb|ADN96593.1| thioredoxin h [Vitis vinifera] Length = 115 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKH 114 +W+ EAMPTF+FLK GK+V+KVVGANKD LQ TIAKH Sbjct: 75 DWAVEAMPTFMFLKQGKIVDKVVGANKDSLQQTIAKH 111 >emb|CBI17430.3| unnamed protein product [Vitis vinifera] Length = 152 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKH 114 +W+ EAMPTF+FLK GK+V+KVVGANKD LQ TIAKH Sbjct: 112 DWAVEAMPTFMFLKQGKIVDKVVGANKDSLQQTIAKH 148 >ref|XP_002274205.1| PREDICTED: thioredoxin H-type 2 [Vitis vinifera] gi|452114364|gb|AGG09339.1| thioredoxin h1 [Vitis vinifera] Length = 115 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKH 114 +W+ EAMPTF+FLK GK+V+KVVGANKD LQ TIAKH Sbjct: 75 DWAVEAMPTFMFLKQGKIVDKVVGANKDSLQQTIAKH 111 >gb|AAZ98842.1| thioredoxin h1 [Medicago truncatula] Length = 117 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 EW+ +AMPTF+FLK+GKLV+KVVGA KD LQ+ I KHAT Sbjct: 76 EWAVDAMPTFLFLKEGKLVDKVVGAQKDQLQAAITKHAT 114 >ref|XP_002307687.1| thioredoxin h family protein [Populus trichocarpa] gi|19851972|gb|AAL99941.1| thioredoxin H [Populus tremula x Populus tremuloides] gi|118485155|gb|ABK94440.1| unknown [Populus trichocarpa] gi|222857136|gb|EEE94683.1| thioredoxin h family protein [Populus trichocarpa] Length = 114 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 EW+ EAMPTFIFLKDGKLV+K VGA+KD L + +AKHAT Sbjct: 75 EWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHAT 113 >gb|AEC03317.1| thioredoxin H-type 3 [Hevea brasiliensis] Length = 118 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 +W+ EAMPTF+FLK+GK+++KVVGA K+ LQ TIAKHAT Sbjct: 75 DWAVEAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHAT 113 >ref|XP_003527904.1| PREDICTED: thioredoxin H-type [Glycine max] Length = 117 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHATM 123 EW EAMPTF+FLK+GKLV+KVVGA K+ LQ TIAKHA + Sbjct: 75 EWGIEAMPTFLFLKEGKLVDKVVGAKKEELQLTIAKHAAI 114 >ref|XP_003550402.1| PREDICTED: thioredoxin H-type [Glycine max] Length = 123 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 E+S EAMPTF+FLKDG++V+KVVGA+KD LQ+TIAKHA+ Sbjct: 77 EYSIEAMPTFLFLKDGEIVDKVVGASKDDLQATIAKHAS 115 >sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 1 AEWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHA 117 AEWS EAMPTF+F+KDGK V++VVGA K+ LQ TI KHA Sbjct: 81 AEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHA 119 >gb|AEI69284.1| thioredoxin h 1-2 [Galega orientalis] Length = 117 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 EW+ EAMPTF+FLK+GKLV+KVVGA K+ LQ I+KHAT Sbjct: 76 EWAIEAMPTFLFLKEGKLVDKVVGAQKETLQLAISKHAT 114 >ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus communis] gi|223551157|gb|EEF52643.1| Thioredoxin H-type, putative [Ricinus communis] Length = 118 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 +W+ EAMPTF+FLK+GK+V KVVGANK+ LQ TIAK+AT Sbjct: 75 DWAVEAMPTFMFLKEGKIVHKVVGANKEELQMTIAKYAT 113 >ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] gi|482561483|gb|EOA25674.1| hypothetical protein CARUB_v10019026mg [Capsella rubella] Length = 114 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = +1 Query: 1 AEWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKH 114 ++W+ EAMPTF+FLK+GK+++KVVGA KD LQSTIAKH Sbjct: 75 SDWAIEAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112 >gb|AAZ32865.1| thioredoxin h [Medicago sativa] Length = 117 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 EW+ +AMPTF+FLK+GKLV+KVVGA K+ LQ+ I KHAT Sbjct: 76 EWAVDAMPTFLFLKEGKLVDKVVGAQKEQLQAAITKHAT 114 >gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] Length = 120 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKH 114 +W+ EAMPTF+FLK+GK+V+KVVGA KD LQ TIAKH Sbjct: 76 DWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 112 >sp|Q07090.1|TRXH2_TOBAC RecName: Full=Thioredoxin H-type 2; Short=Trx-H2 gi|297519|emb|CAA77847.1| THIOREDOXIN [Nicotiana tabacum] gi|447151|prf||1913431A thioredoxin Length = 118 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKH 114 +W+ EAMPTF+FLK+GK+V+KVVGA KD LQ TIAKH Sbjct: 75 DWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111 >gb|AEC03323.1| thioredoxin H-type 8 [Hevea brasiliensis] Length = 118 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +1 Query: 4 EWSAEAMPTFIFLKDGKLVEKVVGANKDLLQSTIAKHAT 120 +W+ +AMPTF+FLK+GK+++KVVGA K+ LQ TIAKHAT Sbjct: 75 DWAVKAMPTFMFLKEGKIIDKVVGAKKEELQQTIAKHAT 113