BLASTX nr result
ID: Rheum21_contig00000678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00000678 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV60370.1| lectin [Limonium bicolor] 59 7e-07 >gb|ABV60370.1| lectin [Limonium bicolor] Length = 221 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/59 (44%), Positives = 38/59 (64%) Frame = +1 Query: 178 QCKEIMKSHKCPMPISSEEALWERLREGVLVDGDKYFWLDNKARLSVELYARALTITWG 354 +CK +++ H P+ + L L++GVLV+G+ FW D RLS E +ARAL+ITWG Sbjct: 20 KCKNVLRGHNQPVDHLCDNDLISTLKKGVLVNGNTLFWADETLRLSCEKFARALSITWG 78