BLASTX nr result
ID: Rheum21_contig00000232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rheum21_contig00000232 (775 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ24753.1| hypothetical protein PRUPE_ppa014532mg [Prunus pe... 79 2e-12 ref|XP_004247859.1| PREDICTED: uncharacterized protein LOC101265... 75 3e-11 ref|XP_004138960.1| PREDICTED: uncharacterized protein LOC101214... 74 4e-11 ref|XP_006366843.1| PREDICTED: putative SERF-like protein-like [... 74 6e-11 gb|AFX67001.1| 4F5 protein family protein [Solanum tuberosum] 74 6e-11 ref|XP_006599192.1| PREDICTED: putative SERF-like protein-like [... 73 9e-11 ref|XP_006493051.1| PREDICTED: putative SERF-like protein-like [... 73 9e-11 ref|XP_006420916.1| hypothetical protein CICLE_v10006390mg [Citr... 73 9e-11 ref|XP_006375240.1| hypothetical protein POPTR_0014s05560g [Popu... 72 2e-10 ref|XP_006373059.1| hypothetical protein POPTR_0017s08260g [Popu... 72 2e-10 ref|XP_006602502.1| PREDICTED: uncharacterized LOC100305502 [Gly... 72 2e-10 gb|EOX93916.1| Uncharacterized protein isoform 1 [Theobroma cacao] 72 2e-10 ref|XP_006369804.1| hypothetical protein POPTR_0001s32260g [Popu... 71 4e-10 ref|XP_006414978.1| hypothetical protein EUTSA_v10026728mg [Eutr... 70 8e-10 ref|XP_004296762.1| PREDICTED: uncharacterized protein LOC101308... 70 1e-09 ref|XP_001752642.1| predicted protein [Physcomitrella patens] gi... 70 1e-09 ref|XP_002521083.1| conserved hypothetical protein [Ricinus comm... 69 1e-09 ref|XP_004513527.1| PREDICTED: putative SERF-like protein-like [... 69 2e-09 ref|XP_006285111.1| hypothetical protein CARUB_v10006444mg [Caps... 69 2e-09 emb|CBI25688.3| unnamed protein product [Vitis vinifera] 69 2e-09 >gb|EMJ24753.1| hypothetical protein PRUPE_ppa014532mg [Prunus persica] Length = 64 Score = 79.0 bits (193), Expect = 2e-12 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQK-KDDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+AQARGGK K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAQARGGKGKNKDDGLTPEQRRERDAKALQE 43 >ref|XP_004247859.1| PREDICTED: uncharacterized protein LOC101265069 [Solanum lycopersicum] Length = 67 Score = 74.7 bits (182), Expect = 3e-11 Identities = 38/44 (86%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQKK--DDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+A AR GK KK DDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAAARAGKSKKGADDGLTPEQRRERDAKALQE 44 >ref|XP_004138960.1| PREDICTED: uncharacterized protein LOC101214231 [Cucumis sativus] gi|449526243|ref|XP_004170123.1| PREDICTED: uncharacterized protein LOC101231850 [Cucumis sativus] Length = 68 Score = 74.3 bits (181), Expect = 4e-11 Identities = 40/44 (90%), Positives = 41/44 (93%), Gaps = 2/44 (4%) Frame = +1 Query: 217 MTRGNQREKDREKAQAR-GGKQK-KDDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+AQAR GGK K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERDAKALQE 44 >ref|XP_006366843.1| PREDICTED: putative SERF-like protein-like [Solanum tuberosum] Length = 67 Score = 73.9 bits (180), Expect = 6e-11 Identities = 38/44 (86%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQKK--DDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+A AR GK KK DDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAAARAGKGKKGGDDGLTPEQRRERDAKALQE 44 >gb|AFX67001.1| 4F5 protein family protein [Solanum tuberosum] Length = 67 Score = 73.9 bits (180), Expect = 6e-11 Identities = 38/44 (86%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQKK--DDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+A AR GK KK DDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAAARAGKGKKGGDDGLTPEQRRERDAKALQE 44 >ref|XP_006599192.1| PREDICTED: putative SERF-like protein-like [Glycine max] Length = 66 Score = 73.2 bits (178), Expect = 9e-11 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 3/45 (6%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 MTRGNQRE+DRE+AQAR G KQ K+DGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQRERDRERAQARAGGKTKQPKNDGLTPEQRRERDAKALQE 45 >ref|XP_006493051.1| PREDICTED: putative SERF-like protein-like [Citrus sinensis] Length = 66 Score = 73.2 bits (178), Expect = 9e-11 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQK-KDDGLTPEQRRERDAKALQE 342 MTRGNQRE+DRE+A ARG K K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQRERDRERAAARGSKGKTKDDGLTPEQRRERDAKALQE 43 >ref|XP_006420916.1| hypothetical protein CICLE_v10006390mg [Citrus clementina] gi|557522789|gb|ESR34156.1| hypothetical protein CICLE_v10006390mg [Citrus clementina] Length = 66 Score = 73.2 bits (178), Expect = 9e-11 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQK-KDDGLTPEQRRERDAKALQE 342 MTRGNQRE+DRE+A ARG K K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQRERDRERAAARGSKGKTKDDGLTPEQRRERDAKALQE 43 >ref|XP_006375240.1| hypothetical protein POPTR_0014s05560g [Populus trichocarpa] gi|550323559|gb|ERP53037.1| hypothetical protein POPTR_0014s05560g [Populus trichocarpa] Length = 71 Score = 72.4 bits (176), Expect = 2e-10 Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 3/45 (6%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 MTRGNQRE+DRE+AQAR G K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQRERDRERAQARVGHKTKNSKDDGLTPEQRRERDAKALQE 45 >ref|XP_006373059.1| hypothetical protein POPTR_0017s08260g [Populus trichocarpa] gi|118482809|gb|ABK93321.1| unknown [Populus trichocarpa] gi|550319760|gb|ERP50856.1| hypothetical protein POPTR_0017s08260g [Populus trichocarpa] Length = 68 Score = 72.4 bits (176), Expect = 2e-10 Identities = 39/44 (88%), Positives = 40/44 (90%), Gaps = 2/44 (4%) Frame = +1 Query: 217 MTRGNQREKDREKAQAR-GGKQK-KDDGLTPEQRRERDAKALQE 342 M RGNQREKDRE+AQAR GGK K KDDGLTPEQRRERDAKALQE Sbjct: 1 MARGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERDAKALQE 44 >ref|XP_006602502.1| PREDICTED: uncharacterized LOC100305502 [Glycine max] Length = 64 Score = 72.0 bits (175), Expect = 2e-10 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 2/44 (4%) Frame = +1 Query: 217 MTRGNQREKDREKAQAR-GGKQK-KDDGLTPEQRRERDAKALQE 342 MTRGNQR++DRE+AQAR GGK K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQRDRDRERAQARTGGKGKQKDDGLTPEQRRERDAKALQE 44 >gb|EOX93916.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 71 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 3/45 (6%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 MTRGNQRE+DRE+AQAR G K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQRERDRERAQARTGNKGKSVKDDGLTPEQRRERDAKALQE 45 >ref|XP_006369804.1| hypothetical protein POPTR_0001s32260g [Populus trichocarpa] gi|550348696|gb|ERP66373.1| hypothetical protein POPTR_0001s32260g [Populus trichocarpa] Length = 69 Score = 71.2 bits (173), Expect = 4e-10 Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 3/45 (6%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+AQARGG + KDDGLT EQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAQARGGNKVNKGKDDGLTHEQRRERDAKALQE 45 >ref|XP_006414978.1| hypothetical protein EUTSA_v10026728mg [Eutrema salsugineum] gi|557116148|gb|ESQ56431.1| hypothetical protein EUTSA_v10026728mg [Eutrema salsugineum] Length = 72 Score = 70.1 bits (170), Expect = 8e-10 Identities = 35/45 (77%), Positives = 39/45 (86%), Gaps = 3/45 (6%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 M RGNQRE+DRE+AQARG KQ K+DGLTPEQRRERDA+ALQE Sbjct: 1 MARGNQRERDRERAQARGNHKPKQPKNDGLTPEQRRERDARALQE 45 >ref|XP_004296762.1| PREDICTED: uncharacterized protein LOC101308563 [Fragaria vesca subsp. vesca] Length = 67 Score = 69.7 bits (169), Expect = 1e-09 Identities = 36/43 (83%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQK-KDDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+A AR K KDDGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAAARAKASKNKDDGLTPEQRRERDAKALQE 43 >ref|XP_001752642.1| predicted protein [Physcomitrella patens] gi|162696173|gb|EDQ82513.1| predicted protein [Physcomitrella patens] Length = 110 Score = 69.7 bits (169), Expect = 1e-09 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = +1 Query: 202 VVQLAMTRGNQREKDREKAQARGGKQK-KDDGLTPEQRRERDAKALQE 342 VV MTRGNQREKDRE+A AR K +DDGLTPEQRRERDAKALQE Sbjct: 41 VVLARMTRGNQREKDRERAAARAKTTKARDDGLTPEQRRERDAKALQE 88 >ref|XP_002521083.1| conserved hypothetical protein [Ricinus communis] gi|223539652|gb|EEF41234.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 3/43 (6%) Frame = +1 Query: 223 RGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 RGNQRE+DRE+AQAR G K KDDGLTPEQRRERDAKALQE Sbjct: 12 RGNQRERDRERAQARAGQKPKNPKDDGLTPEQRRERDAKALQE 54 >ref|XP_004513527.1| PREDICTED: putative SERF-like protein-like [Cicer arietinum] Length = 66 Score = 68.9 bits (167), Expect = 2e-09 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 217 MTRGNQREKDREKAQARGGKQK----KDDGLTPEQRRERDAKALQE 342 MTRGNQREKDRE+AQ+R G K K DGLTPEQRRERDAKALQE Sbjct: 1 MTRGNQREKDRERAQSRTGGSKGKPVKTDGLTPEQRRERDAKALQE 46 >ref|XP_006285111.1| hypothetical protein CARUB_v10006444mg [Capsella rubella] gi|482553816|gb|EOA18009.1| hypothetical protein CARUB_v10006444mg [Capsella rubella] Length = 134 Score = 68.9 bits (167), Expect = 2e-09 Identities = 35/47 (74%), Positives = 39/47 (82%), Gaps = 3/47 (6%) Frame = +1 Query: 211 LAMTRGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 L RGNQRE+DRE+AQARG KQ K+DGLTPEQRRERDA+ALQE Sbjct: 61 LCSKRGNQRERDRERAQARGNHKPKQPKNDGLTPEQRRERDARALQE 107 >emb|CBI25688.3| unnamed protein product [Vitis vinifera] Length = 107 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 3/43 (6%) Frame = +1 Query: 223 RGNQREKDREKAQARGG---KQKKDDGLTPEQRRERDAKALQE 342 RGNQR++DRE+AQAR G KQ KDDGLTPEQRRERDAKALQE Sbjct: 34 RGNQRDRDRERAQARIGHKSKQAKDDGLTPEQRRERDAKALQE 76