BLASTX nr result
ID: Rehmannia32_contig00027862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00027862 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020549117.1| uncharacterized protein LOC105160179 [Sesamu... 58 6e-07 >ref|XP_020549117.1| uncharacterized protein LOC105160179 [Sesamum indicum] Length = 293 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/71 (35%), Positives = 36/71 (50%) Frame = -1 Query: 213 PSAFVILAPGSGDMLTHPPKGFITVYLYSFSVGFVLPPDTFLILILRSMGACVG*LIPQV 34 PSA + P G + PP G TVY F GF +PP L+ ++RS G C+ L P Sbjct: 133 PSAHKFILPSRGRRIRDPPAGCFTVYTAYFDNGFSIPPHPLLVKVIRSYGVCISQLTPNS 192 Query: 33 YACIRGYQHAI 1 + C G++ + Sbjct: 193 FMCFEGWRRRL 203