BLASTX nr result
ID: Rehmannia32_contig00027824
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00027824 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN48572.1| hypothetical protein glysoja_034195 [Glycine soja] 76 3e-14 ref|XP_003519400.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 76 2e-13 gb|KHN20839.1| hypothetical protein glysoja_009147 [Glycine soja] 74 2e-13 ref|XP_023903724.1| probable 1-aminocyclopropane-1-carboxylate o... 75 3e-13 ref|XP_002528301.2| PREDICTED: gibberellin 2-beta-dioxygenase 2 ... 73 3e-12 gb|EEF34059.1| conserved hypothetical protein [Ricinus communis] 73 3e-12 ref|XP_011076832.1| 1-aminocyclopropane-1-carboxylate oxidase 2,... 71 6e-12 ref|XP_019433687.1| PREDICTED: uncharacterized protein LOC109340... 70 3e-11 emb|CDP14005.1| unnamed protein product [Coffea canephora] 70 4e-11 gb|PON86588.1| Isopenicillin N synthase-like protein [Trema orie... 69 5e-11 ref|XP_015077852.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2 ... 69 9e-11 ref|XP_004240932.1| PREDICTED: gibberellin 2-beta-dioxygenase 3 ... 68 1e-10 gb|PON78985.1| Non-heme dioxygenase N-terminal domain containing... 68 1e-10 ref|XP_018434487.1| PREDICTED: uncharacterized protein LOC108806... 68 2e-10 ref|XP_019151710.1| PREDICTED: 2-oxoglutarate-dependent dioxygen... 68 2e-10 gb|EYU19996.1| hypothetical protein MIMGU_mgv1a011036mg [Erythra... 66 4e-10 ref|XP_007141756.1| hypothetical protein PHAVU_008G223100g [Phas... 66 6e-10 ref|XP_019243786.1| PREDICTED: gibberellin 2-beta-dioxygenase 1 ... 66 6e-10 ref|XP_012858119.1| PREDICTED: uncharacterized protein LOC105977... 66 6e-10 ref|XP_021659061.1| gibberellin 2-beta-dioxygenase 2-like [Hevea... 66 8e-10 >gb|KHN48572.1| hypothetical protein glysoja_034195 [Glycine soja] Length = 192 Score = 75.9 bits (185), Expect = 3e-14 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 E E E++E +D + LEKR+FNSF FEDYAWRVYHERIL KDPL RYRV Sbjct: 142 EIEGEEEENNDGGDEELEKRVFNSFDFEDYAWRVYHERILFKDPLDRYRV 191 >ref|XP_003519400.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Glycine max] gb|KRH73200.1| hypothetical protein GLYMA_02G257900 [Glycine max] Length = 360 Score = 75.9 bits (185), Expect = 2e-13 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 E E E++E +D + LEKR+FNSF FEDYAWRVYHERIL KDPL RYRV Sbjct: 310 EIEGEEEENNDGGDEELEKRVFNSFDFEDYAWRVYHERILFKDPLDRYRV 359 >gb|KHN20839.1| hypothetical protein glysoja_009147 [Glycine soja] Length = 192 Score = 73.6 bits (179), Expect = 2e-13 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 +EE+ D+E +D ++ LEKR+FNSF FEDYAWRVYHERI+ KDPL RYRV Sbjct: 143 KEEEVDEESNDGGEE-LEKRVFNSFDFEDYAWRVYHERIIFKDPLDRYRV 191 >ref|XP_023903724.1| probable 1-aminocyclopropane-1-carboxylate oxidase [Quercus suber] Length = 377 Score = 75.5 bits (184), Expect = 3e-13 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 +E ++D+E SD + E+RLFNSFSFEDYAWRVYHERIL KDPL RYR+ Sbjct: 328 DEIEKDEEQSDGSSGEREERLFNSFSFEDYAWRVYHERILFKDPLDRYRI 377 >ref|XP_002528301.2| PREDICTED: gibberellin 2-beta-dioxygenase 2 [Ricinus communis] Length = 389 Score = 72.8 bits (177), Expect = 3e-12 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 EEE+++K+G + KK EKR+FNSFSFEDYAWRVYHE + KDPL +YR+ Sbjct: 340 EEEEDEKDGKNVVKK--EKRMFNSFSFEDYAWRVYHEPFIFKDPLDKYRI 387 >gb|EEF34059.1| conserved hypothetical protein [Ricinus communis] Length = 435 Score = 72.8 bits (177), Expect = 3e-12 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 EEE+++K+G + KK EKR+FNSFSFEDYAWRVYHE + KDPL +YR+ Sbjct: 386 EEEEDEKDGKNVVKK--EKRMFNSFSFEDYAWRVYHEPFIFKDPLDKYRI 433 >ref|XP_011076832.1| 1-aminocyclopropane-1-carboxylate oxidase 2, partial [Sesamum indicum] Length = 299 Score = 71.2 bits (173), Expect = 6e-12 Identities = 34/48 (70%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = +1 Query: 16 EDKEGS--DSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 E++EG DS E+RLFNSFSFEDYAWRVY+ER+LLKDPL+RYRV Sbjct: 252 ENEEGGEHDSPNNNREQRLFNSFSFEDYAWRVYNERLLLKDPLIRYRV 299 >ref|XP_019433687.1| PREDICTED: uncharacterized protein LOC109340444 [Lupinus angustifolius] Length = 383 Score = 70.1 bits (170), Expect = 3e-11 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 E+E+E++EG++ LE R+FNSF FEDYAWR+YHER+ LKDPL RYR+ Sbjct: 334 EKEEEEEEGNNGGNGELE-RVFNSFDFEDYAWRIYHERLYLKDPLDRYRI 382 >emb|CDP14005.1| unnamed protein product [Coffea canephora] Length = 389 Score = 69.7 bits (169), Expect = 4e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +1 Query: 10 EQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYR 150 E+ D E S+K E+R+FNSFSFEDYAWR+YHER+ KDPL+RYR Sbjct: 327 EERDPENDCSSKSAKEERIFNSFSFEDYAWRIYHERLHSKDPLLRYR 373 >gb|PON86588.1| Isopenicillin N synthase-like protein [Trema orientalis] Length = 390 Score = 69.3 bits (168), Expect = 5e-11 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +1 Query: 10 EQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 E+E++ D ++ EKR+FNSFSFEDYAWRVYHER+ KDPL RYR+ Sbjct: 341 EEEEELADDDDEEEEEKRVFNSFSFEDYAWRVYHERLHFKDPLDRYRI 388 >ref|XP_015077852.1| PREDICTED: feruloyl CoA ortho-hydroxylase 2 [Solanum pennellii] Length = 380 Score = 68.6 bits (166), Expect = 9e-11 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = +1 Query: 1 PEEEQEDKEGSDSTKKPL----EKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 P ++D D+ K + E ++FNSFSFEDYAWRVYHER++LKDPLVRYRV Sbjct: 326 PSLSEDDDGLGDNDSKTIAVEEESQMFNSFSFEDYAWRVYHERLILKDPLVRYRV 380 >ref|XP_004240932.1| PREDICTED: gibberellin 2-beta-dioxygenase 3 [Solanum lycopersicum] Length = 380 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/51 (62%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = +1 Query: 10 EQEDKEGSDSTKKPL---EKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 E +D G++ +K E ++FNSFSFEDYAWRVYHER++LKDPLVRYRV Sbjct: 330 EDDDGLGNNDSKTIAVEEESQMFNSFSFEDYAWRVYHERLILKDPLVRYRV 380 >gb|PON78985.1| Non-heme dioxygenase N-terminal domain containing protein [Parasponia andersonii] Length = 388 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = +1 Query: 10 EQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 E+E++E +D ++ EKR+FNSFSFEDYAWRVYHER+ KDPL RYR+ Sbjct: 341 EEEEEELADDEEE--EKRMFNSFSFEDYAWRVYHERLNFKDPLDRYRI 386 >ref|XP_018434487.1| PREDICTED: uncharacterized protein LOC108806793 [Raphanus sativus] Length = 374 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 EEE+E+ E + + E R F SF FEDYAWRVYHER+ KDPLVRYR+ Sbjct: 323 EEEEENAEEEEEGSRCNEGRAFKSFCFEDYAWRVYHERLFFKDPLVRYRI 372 >ref|XP_019151710.1| PREDICTED: 2-oxoglutarate-dependent dioxygenase DAO [Ipomoea nil] Length = 376 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 +E +ED +G E+R+FN F FEDYAWR+YHER+LLKDPL+RYRV Sbjct: 335 QEHEEDSKG--------ERRMFNPFPFEDYAWRIYHERLLLKDPLLRYRV 376 >gb|EYU19996.1| hypothetical protein MIMGU_mgv1a011036mg [Erythranthe guttata] Length = 294 Score = 66.2 bits (160), Expect = 4e-10 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +1 Query: 19 DKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 D G D E LFNSFSFE+YAWRVYHER+LLKDPL+RYRV Sbjct: 252 DSTGDDDRSS--EAPLFNSFSFEEYAWRVYHERLLLKDPLIRYRV 294 >ref|XP_007141756.1| hypothetical protein PHAVU_008G223100g [Phaseolus vulgaris] gb|ESW13750.1| hypothetical protein PHAVU_008G223100g [Phaseolus vulgaris] Length = 371 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 EE++E +E ++ + E+R+FNSF FEDYAWRVYHE I+ KDPL RYRV Sbjct: 319 EEKEEVEEENNCGDEEEEERVFNSFDFEDYAWRVYHELIIFKDPLDRYRV 368 >ref|XP_019243786.1| PREDICTED: gibberellin 2-beta-dioxygenase 1 [Nicotiana attenuata] gb|OIT05001.1| hypothetical protein A4A49_36286 [Nicotiana attenuata] Length = 379 Score = 66.2 bits (160), Expect = 6e-10 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +1 Query: 1 PEEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 P+ Q +G ++++ P +FN FSFEDYAWRVYHER+LLKDPLVRYR+ Sbjct: 332 PKSPQPVDDGENNSESP---PMFNPFSFEDYAWRVYHERLLLKDPLVRYRL 379 >ref|XP_012858119.1| PREDICTED: uncharacterized protein LOC105977365 [Erythranthe guttata] Length = 389 Score = 66.2 bits (160), Expect = 6e-10 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = +1 Query: 19 DKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 D G D E LFNSFSFE+YAWRVYHER+LLKDPL+RYRV Sbjct: 347 DSTGDDDRSS--EAPLFNSFSFEEYAWRVYHERLLLKDPLIRYRV 389 >ref|XP_021659061.1| gibberellin 2-beta-dioxygenase 2-like [Hevea brasiliensis] Length = 373 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = +1 Query: 4 EEEQEDKEGSDSTKKPLEKRLFNSFSFEDYAWRVYHERILLKDPLVRYRV 153 EE +E G S K E RLF+SFSFEDYAWRVYHE +LLKDPL +YR+ Sbjct: 323 EEVEEQSHGIGSNSKE-EGRLFSSFSFEDYAWRVYHEPLLLKDPLDKYRI 371