BLASTX nr result
ID: Rehmannia32_contig00027433
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00027433 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN13079.1| hypothetical protein CDL12_14305 [Handroanthus im... 57 9e-07 >gb|PIN13079.1| hypothetical protein CDL12_14305 [Handroanthus impetiginosus] Length = 735 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -3 Query: 394 HGLMEARGYVSSQQLKMAMMASQAIGKSSKRNKFSLIRDK 275 HGLMEARG+V S++LK+A++A + +GKS K NK SL+RDK Sbjct: 696 HGLMEARGFVLSERLKVALLARETVGKSDKSNKSSLVRDK 735