BLASTX nr result
ID: Rehmannia32_contig00027399
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00027399 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020548041.1| pentatricopeptide repeat-containing protein ... 190 7e-54 ref|XP_012855649.1| PREDICTED: pentatricopeptide repeat-containi... 159 1e-42 ref|XP_022845009.1| putative pentatricopeptide repeat-containing... 107 3e-24 ref|XP_012473689.1| PREDICTED: pentatricopeptide repeat-containi... 104 3e-23 gb|OMO77343.1| hypothetical protein CCACVL1_15065 [Corchorus cap... 104 3e-23 ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containi... 103 7e-23 gb|OMO93339.1| hypothetical protein COLO4_16973 [Corchorus olito... 102 2e-22 ref|XP_021296182.1| pentatricopeptide repeat-containing protein ... 100 8e-22 ref|XP_019156432.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-21 ref|XP_019156796.1| PREDICTED: pentatricopeptide repeat-containi... 99 2e-21 ref|XP_019156794.1| PREDICTED: pentatricopeptide repeat-containi... 99 3e-21 ref|XP_016700351.1| PREDICTED: pentatricopeptide repeat-containi... 99 4e-21 ref|XP_016740980.1| PREDICTED: pentatricopeptide repeat-containi... 98 5e-21 ref|XP_017973975.1| PREDICTED: pentatricopeptide repeat-containi... 98 5e-21 gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein... 98 5e-21 gb|PPS08190.1| hypothetical protein GOBAR_AA12458 [Gossypium bar... 98 5e-21 ref|XP_022717576.1| pentatricopeptide repeat-containing protein ... 98 7e-21 ref|XP_017623794.1| PREDICTED: pentatricopeptide repeat-containi... 96 3e-20 gb|KCW71754.1| hypothetical protein EUGRSUZ_E00255 [Eucalyptus g... 95 9e-20 ref|XP_010055285.1| PREDICTED: putative pentatricopeptide repeat... 95 9e-20 >ref|XP_020548041.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Sesamum indicum] ref|XP_020548042.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Sesamum indicum] Length = 742 Score = 190 bits (482), Expect = 7e-54 Identities = 100/143 (69%), Positives = 109/143 (76%) Frame = -3 Query: 431 RVSAVPLLDDSDYYXXXXXXXXXXXXNFLRENNRELKSVELFSAVVRVLKSLNWEISRKV 252 RVSA PLL DSDY N LREN E+K++ELFSAVVRV+KSLNW ++RKV Sbjct: 42 RVSAAPLLYDSDYSTSNCESNSDSESNVLRENVHEVKTIELFSAVVRVVKSLNWNVTRKV 101 Query: 251 CFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCYCQKTQLNLFYLSYVLL 72 CF V KYGFDQSLM FKMFV VYACAEMQ+EVYALLREIVCY QK QLNLF L Y LL Sbjct: 102 CFPIAVQKYGFDQSLMGFKMFVYVYACAEMQMEVYALLREIVCYYQKAQLNLFGLLYPLL 161 Query: 71 SCPSDAEGSNFMVNVLIKVFASN 3 P DA+GS F+VNVLIKVFASN Sbjct: 162 DSPGDAKGSTFLVNVLIKVFASN 184 >ref|XP_012855649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63070, mitochondrial-like [Erythranthe guttata] Length = 740 Score = 159 bits (402), Expect = 1e-42 Identities = 81/143 (56%), Positives = 101/143 (70%) Frame = -3 Query: 431 RVSAVPLLDDSDYYXXXXXXXXXXXXNFLRENNRELKSVELFSAVVRVLKSLNWEISRKV 252 RVS +PL DDSD LRENNR+ KS++LFS VVRV KS NW ++K+ Sbjct: 46 RVSTLPLSDDSDCSTSNSESNSESEITVLRENNRDRKSIKLFSTVVRVFKSFNWNAAKKL 105 Query: 251 CFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCYCQKTQLNLFYLSYVLL 72 C A++V+KYG D+ + AF + V+VYACAEMQ+EV+ LLREIVC QK L+LF + Y LL Sbjct: 106 CSAKSVEKYGIDRWVAAFNVVVRVYACAEMQMEVHHLLREIVCCYQKAGLDLFDIPYALL 165 Query: 71 SCPSDAEGSNFMVNVLIKVFASN 3 PSDAEGS F+VN L+KVFASN Sbjct: 166 DSPSDAEGSTFLVNELVKVFASN 188 >ref|XP_022845009.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845010.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845011.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845012.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845013.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845014.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845015.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845016.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845018.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] Length = 801 Score = 107 bits (267), Expect = 3e-24 Identities = 55/111 (49%), Positives = 78/111 (70%) Frame = -3 Query: 335 NRELKSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQL 156 + + K +LFS VV VLKSLNW+ +R++ ++YGF+QS+ A+ M V ++ACAEM + Sbjct: 82 HEQRKGNKLFSVVVGVLKSLNWQAARQINLLSATEQYGFNQSINAYIMMVHIFACAEMHM 141 Query: 155 EVYALLREIVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 EVYALLR+I+ QK L+L+ L + LL S+A S +VNVL+KVFASN Sbjct: 142 EVYALLRDIIYCYQKFDLDLYGLIFTLLDRSSNAAISTHIVNVLVKVFASN 192 >ref|XP_012473689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] ref|XP_012473690.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] ref|XP_012473691.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] ref|XP_012473692.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] ref|XP_012473693.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] ref|XP_012473694.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] ref|XP_012473695.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium raimondii] gb|KJB22791.1| hypothetical protein B456_004G065800 [Gossypium raimondii] Length = 738 Score = 104 bits (260), Expect = 3e-23 Identities = 51/107 (47%), Positives = 70/107 (65%) Frame = -3 Query: 323 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 144 ++ LF VVRV KSLNW +RK+ F V YGFD S+ AF++ + ++A MQ+E +A Sbjct: 73 RNPSLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHSIYAFRIIIHIFAMTGMQMEAHA 132 Query: 143 LLREIVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 LLR+IVCYC+ ++++F L LL P S + NVLIKVFASN Sbjct: 133 LLRDIVCYCEGVKIDVFELLPYLLDSPEHVHRSTSVFNVLIKVFASN 179 >gb|OMO77343.1| hypothetical protein CCACVL1_15065 [Corchorus capsularis] Length = 1517 Score = 104 bits (260), Expect = 3e-23 Identities = 51/103 (49%), Positives = 73/103 (70%) Frame = -3 Query: 311 LFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLRE 132 LF VVRVLKSLNW+++R++ F V+ YGFD S+ F++ + ++A A MQ+EVY+LLR+ Sbjct: 850 LFPLVVRVLKSLNWDVAREIRFYMAVNMYGFDHSIYMFRIIIHIFAMAGMQMEVYSLLRD 909 Query: 131 IVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 IVCY ++ ++++F L LL P S + NVLIKVFASN Sbjct: 910 IVCYYKEFKMDIFELLPCLLDSPDHVHRSADVFNVLIKVFASN 952 >ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_010663283.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_010663291.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_010663306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_019080195.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_019080198.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_019080200.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] emb|CBI33854.3| unnamed protein product, partial [Vitis vinifera] Length = 767 Score = 103 bits (257), Expect = 7e-23 Identities = 54/115 (46%), Positives = 75/115 (65%) Frame = -3 Query: 347 LRENNRELKSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACA 168 ++ +R + L VV+V KSLNWE++R + F+ T+ KYGF +S+ AF+ V V A A Sbjct: 78 MKRRSRIHRKHVLSPVVVKVFKSLNWEVARHIKFSTTMKKYGFSRSIDAFRTVVNVLALA 137 Query: 167 EMQLEVYALLREIVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 M +EVYALLR+IVCY K L+ F L +LL P DA S + ++LIKVFA+N Sbjct: 138 GMHMEVYALLRDIVCYYNKVNLDAFELFPILLESPKDAARSVIVFDLLIKVFAAN 192 >gb|OMO93339.1| hypothetical protein COLO4_16973 [Corchorus olitorius] Length = 1800 Score = 102 bits (254), Expect = 2e-22 Identities = 51/103 (49%), Positives = 72/103 (69%) Frame = -3 Query: 311 LFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLRE 132 LF VVRVLKSLNW+I+R++ V+ YGFD S+ F++ + ++A A MQ+EVY+LLR+ Sbjct: 1133 LFPLVVRVLKSLNWDIAREIRVYMAVNMYGFDHSIYMFRIIIHIFAMAGMQMEVYSLLRD 1192 Query: 131 IVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 IVCY ++ ++++F L LL P S + NVLIKVFASN Sbjct: 1193 IVCYYKEFKMDIFELLPCLLDSPDHVHRSADVFNVLIKVFASN 1235 >ref|XP_021296182.1| pentatricopeptide repeat-containing protein At5g39710-like [Herrania umbratica] ref|XP_021296190.1| pentatricopeptide repeat-containing protein At5g39710-like [Herrania umbratica] ref|XP_021296198.1| pentatricopeptide repeat-containing protein At5g39710-like [Herrania umbratica] Length = 746 Score = 100 bits (249), Expect = 8e-22 Identities = 50/103 (48%), Positives = 69/103 (66%) Frame = -3 Query: 311 LFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLRE 132 L VVRV KSLNW+I+R++ F V YGFD S+ AF++ + ++A A MQ+E +ALLR+ Sbjct: 77 LIPLVVRVFKSLNWDIAREIRFNMAVKMYGFDHSMYAFRIIIHIFAMAGMQMEAHALLRD 136 Query: 131 IVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 IVCY ++ + ++F L LL P S + NVLIKVFASN Sbjct: 137 IVCYYREVKTDMFELLLYLLDSPEHVHRSADVFNVLIKVFASN 179 >ref|XP_019156432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like [Ipomoea nil] ref|XP_019156433.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like [Ipomoea nil] Length = 711 Score = 99.4 bits (246), Expect = 2e-21 Identities = 59/144 (40%), Positives = 88/144 (61%), Gaps = 2/144 (1%) Frame = -3 Query: 428 VSAVPLLDDSDYYXXXXXXXXXXXXNFL--RENNRELKSVELFSAVVRVLKSLNWEISRK 255 VS+ +LDDSD + R+ K + L S V+RV KSL+WE++R Sbjct: 43 VSSALVLDDSDSCSNGESSGEYEPIVPIISRKRLHRCKELGLCSVVLRVYKSLSWEVARD 102 Query: 254 VCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCYCQKTQLNLFYLSYVL 75 + F R +++YG +S+ AFKM V ++A M++E+YALL++IV Y QK L L L Sbjct: 103 IRFERAMERYGLFESITAFKMLVHIFAYVGMRMEMYALLKDIVFYFQKAGFELDKLLPHL 162 Query: 74 LSCPSDAEGSNFMVNVLIKVFASN 3 L+ P++A+ S F+V+VLIKVFA+N Sbjct: 163 LNSPNNAKISAFVVDVLIKVFAAN 186 >ref|XP_019156796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like isoform X2 [Ipomoea nil] Length = 521 Score = 99.0 bits (245), Expect = 2e-21 Identities = 60/144 (41%), Positives = 87/144 (60%), Gaps = 2/144 (1%) Frame = -3 Query: 428 VSAVPLLDDSDYYXXXXXXXXXXXXNFL--RENNRELKSVELFSAVVRVLKSLNWEISRK 255 VS+ +LDDSD + R+ K + L S VVRV KSL+WE +R+ Sbjct: 43 VSSALVLDDSDSCSNGESSGEYEPIVPIISRKRLHRCKELGLCSVVVRVYKSLSWEAARE 102 Query: 254 VCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCYCQKTQLNLFYLSYVL 75 + F R +++YG QS+ AFKM V ++A M++E+YALL++IV Y QK + L L L Sbjct: 103 ISFERAMERYGLFQSITAFKMLVHIFAYVGMRMEMYALLKDIVFYFQKAEFELDKLLPHL 162 Query: 74 LSCPSDAEGSNFMVNVLIKVFASN 3 L+ +DA+ S +V+VLIKVFA+N Sbjct: 163 LNSSTDAKISASVVDVLIKVFAAN 186 >ref|XP_019156794.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Ipomoea nil] Length = 709 Score = 99.0 bits (245), Expect = 3e-21 Identities = 60/144 (41%), Positives = 87/144 (60%), Gaps = 2/144 (1%) Frame = -3 Query: 428 VSAVPLLDDSDYYXXXXXXXXXXXXNFL--RENNRELKSVELFSAVVRVLKSLNWEISRK 255 VS+ +LDDSD + R+ K + L S VVRV KSL+WE +R+ Sbjct: 43 VSSALVLDDSDSCSNGESSGEYEPIVPIISRKRLHRCKELGLCSVVVRVYKSLSWEAARE 102 Query: 254 VCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCYCQKTQLNLFYLSYVL 75 + F R +++YG QS+ AFKM V ++A M++E+YALL++IV Y QK + L L L Sbjct: 103 ISFERAMERYGLFQSITAFKMLVHIFAYVGMRMEMYALLKDIVFYFQKAEFELDKLLPHL 162 Query: 74 LSCPSDAEGSNFMVNVLIKVFASN 3 L+ +DA+ S +V+VLIKVFA+N Sbjct: 163 LNSSTDAKISASVVDVLIKVFAAN 186 >ref|XP_016700351.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] ref|XP_016700358.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] ref|XP_016700365.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] ref|XP_016700373.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] ref|XP_016700378.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium hirsutum] Length = 738 Score = 98.6 bits (244), Expect = 4e-21 Identities = 50/107 (46%), Positives = 68/107 (63%) Frame = -3 Query: 323 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 144 ++ LF VVRV KSLNW +RK+ F V YGFD S+ AF++ + ++A MQ+E +A Sbjct: 73 RNPSLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHSIYAFRIIIHIFAMTGMQMEAHA 132 Query: 143 LLREIVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 LLR+IVCY + + ++F L LL P S + NVLIKVFASN Sbjct: 133 LLRDIVCYYEGVKNDVFELLPYLLDSPEHVHRSTSVFNVLIKVFASN 179 >ref|XP_016740980.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Gossypium hirsutum] ref|XP_016740987.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Gossypium hirsutum] Length = 738 Score = 98.2 bits (243), Expect = 5e-21 Identities = 50/107 (46%), Positives = 68/107 (63%) Frame = -3 Query: 323 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 144 ++ LF VVRV KSLNW +RK+ F V YGFD S+ AF++ + ++A MQ+E +A Sbjct: 73 RNPSLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHSIYAFRIIIHIFAMTGMQMEAHA 132 Query: 143 LLREIVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 LLR+IVCY + + ++F L LL P S + NVLIKVFASN Sbjct: 133 LLRDIVCYYKGVKNDVFELLPYLLDSPEHVHRSTSVFNVLIKVFASN 179 >ref|XP_017973975.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] ref|XP_017973976.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] Length = 746 Score = 98.2 bits (243), Expect = 5e-21 Identities = 48/99 (48%), Positives = 67/99 (67%) Frame = -3 Query: 299 VVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCY 120 VVRV KSLNW+I+R++ F YGFD S+ AF++ + ++A A MQ+E +ALLR+IVCY Sbjct: 81 VVRVFKSLNWDIAREIRFNMAAKMYGFDHSMYAFRIIIHIFAMAGMQMEAHALLRDIVCY 140 Query: 119 CQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 ++ + ++F L LL P S + NVLIKVFASN Sbjct: 141 YKEVKTDMFELLLYLLDSPEHVHRSADVFNVLIKVFASN 179 >gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 746 Score = 98.2 bits (243), Expect = 5e-21 Identities = 48/99 (48%), Positives = 67/99 (67%) Frame = -3 Query: 299 VVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREIVCY 120 VVRV KSLNW+I+R++ F YGFD S+ AF++ + ++A A MQ+E +ALLR+IVCY Sbjct: 81 VVRVFKSLNWDIAREIRFNMAAKMYGFDHSMYAFRIIIHIFAMAGMQMEAHALLRDIVCY 140 Query: 119 CQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 ++ + ++F L LL P S + NVLIKVFASN Sbjct: 141 YKEVKTDMFELLLYLLDSPEHVHRSADVFNVLIKVFASN 179 >gb|PPS08190.1| hypothetical protein GOBAR_AA12458 [Gossypium barbadense] Length = 851 Score = 98.2 bits (243), Expect = 5e-21 Identities = 50/107 (46%), Positives = 68/107 (63%) Frame = -3 Query: 323 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 144 ++ LF VVRV KSLNW +RK+ F V YGFD S+ AF++ + ++A MQ+E +A Sbjct: 73 RNPSLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHSIYAFRIIIHIFAMTGMQMEAHA 132 Query: 143 LLREIVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 LLR+IVCY + + ++F L LL P S + NVLIKVFASN Sbjct: 133 LLRDIVCYYKGVKNDVFELLPYLLDSPEHVHRSTSVFNVLIKVFASN 179 >ref|XP_022717576.1| pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Durio zibethinus] ref|XP_022717584.1| pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Durio zibethinus] ref|XP_022717589.1| pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Durio zibethinus] ref|XP_022717596.1| pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Durio zibethinus] ref|XP_022717603.1| pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Durio zibethinus] ref|XP_022717612.1| pentatricopeptide repeat-containing protein At5g39710-like isoform X1 [Durio zibethinus] Length = 746 Score = 97.8 bits (242), Expect = 7e-21 Identities = 50/102 (49%), Positives = 67/102 (65%) Frame = -3 Query: 308 FSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLREI 129 F VV V KSLNW I++K+ F V YGFD S+ AF++ + ++A A MQ+E +ALLR+I Sbjct: 78 FRFVVSVFKSLNWGIAKKIRFNEAVKMYGFDHSMYAFRIIIHIFAMAGMQMEAHALLRDI 137 Query: 128 VCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 VCY Q+ + ++F L LL P S + NVLIKVFASN Sbjct: 138 VCYYQEVKSDIFELLPYLLDSPEHVHRSVEVFNVLIKVFASN 179 >ref|XP_017623794.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] ref|XP_017623795.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] ref|XP_017623796.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Gossypium arboreum] Length = 738 Score = 96.3 bits (238), Expect = 3e-20 Identities = 49/107 (45%), Positives = 68/107 (63%) Frame = -3 Query: 323 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 144 ++ LF VVRV KSLNW +RK+ F V YGFD S+ AF++ + ++A MQ+E +A Sbjct: 73 RNPSLFPIVVRVFKSLNWCAARKISFHNAVKMYGFDHSIYAFRIIIHIFAMTGMQMEAHA 132 Query: 143 LLREIVCYCQKTQLNLFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 LLR+IVCY + + ++F L LL P S + NVLIKVFAS+ Sbjct: 133 LLRDIVCYYKGVKNDVFELLPYLLDSPEHVHRSTSVFNVLIKVFASS 179 >gb|KCW71754.1| hypothetical protein EUGRSUZ_E00255 [Eucalyptus grandis] Length = 655 Score = 94.7 bits (234), Expect = 9e-20 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 1/110 (0%) Frame = -3 Query: 329 ELKSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEV 150 E LFS V RVLKSLNWE++ ++ F R V+++GF+ S++A +M V V+A M+LEV Sbjct: 27 ERSKYRLFSLVGRVLKSLNWEVAWRIRFQRVVNEHGFEDSVVALRMIVHVFAVTGMRLEV 86 Query: 149 YALLREIVCYCQKTQLN-LFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 YALLR++VCY ++ + L L+ LL +D G + NVLIKVFA+N Sbjct: 87 YALLRDVVCYFKELDADVLEELTDFLLDRLADVVGLAVIYNVLIKVFAAN 136 >ref|XP_010055285.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] ref|XP_010055286.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] ref|XP_010055287.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] ref|XP_010055288.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] ref|XP_018730449.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Eucalyptus grandis] Length = 735 Score = 94.7 bits (234), Expect = 9e-20 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 1/110 (0%) Frame = -3 Query: 329 ELKSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEV 150 E LFS V RVLKSLNWE++ ++ F R V+++GF+ S++A +M V V+A M+LEV Sbjct: 107 ERSKYRLFSLVGRVLKSLNWEVAWRIRFQRVVNEHGFEDSVVALRMIVHVFAVTGMRLEV 166 Query: 149 YALLREIVCYCQKTQLN-LFYLSYVLLSCPSDAEGSNFMVNVLIKVFASN 3 YALLR++VCY ++ + L L+ LL +D G + NVLIKVFA+N Sbjct: 167 YALLRDVVCYFKELDADVLEELTDFLLDRLADVVGLAVIYNVLIKVFAAN 216