BLASTX nr result
ID: Rehmannia32_contig00027246
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00027246 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG16109.1| putative chloride channel, voltage gated [Heliant... 60 8e-09 ref|XP_006388252.1| hypothetical protein POPTR_0261s002202g, par... 59 8e-09 ref|XP_017189314.1| PREDICTED: chloride channel protein CLC-c-li... 60 3e-08 ref|XP_020245643.1| chloride channel protein CLC-c-like [Asparag... 62 5e-08 ref|XP_020253001.1| chloride channel protein CLC-c-like [Asparag... 62 5e-08 gb|ONK57742.1| uncharacterized protein A4U43_C09F3630 [Asparagus... 62 5e-08 ref|XP_019703694.1| PREDICTED: chloride channel protein CLC-c-li... 61 7e-08 gb|PON97512.1| Chloride channel, voltage gated [Trema orientalis] 60 9e-08 gb|PON71265.1| Chloride channel, voltage gated [Parasponia ander... 60 1e-07 ref|XP_017186042.1| PREDICTED: chloride channel protein CLC-c-li... 59 1e-07 gb|PLY72094.1| hypothetical protein LSAT_9X121760 [Lactuca sativa] 60 1e-07 ref|XP_021805092.1| chloride channel protein CLC-c-like [Prunus ... 60 1e-07 gb|OTG04782.1| putative chloride channel, voltage gated, Serine/... 60 2e-07 ref|XP_018817868.1| PREDICTED: chloride channel protein CLC-c is... 60 2e-07 ref|XP_018502792.1| PREDICTED: chloride channel protein CLC-c-li... 60 2e-07 ref|XP_019171671.1| PREDICTED: chloride channel protein CLC-c is... 60 2e-07 gb|PHT41530.1| Chloride channel protein CLC-b, partial [Capsicum... 60 2e-07 gb|ONI14593.1| hypothetical protein PRUPE_4G288000 [Prunus persi... 60 2e-07 ref|XP_020418158.1| chloride channel protein CLC-c isoform X2 [P... 60 2e-07 ref|XP_020261998.1| chloride channel protein CLC-c-like isoform ... 60 2e-07 >gb|OTG16109.1| putative chloride channel, voltage gated [Helianthus annuus] Length = 101 Score = 60.1 bits (144), Expect = 8e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 35 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 63 >ref|XP_006388252.1| hypothetical protein POPTR_0261s002202g, partial [Populus trichocarpa] Length = 48 Score = 58.5 bits (140), Expect = 8e-09 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNG+DAHSILAP TLFVKV Sbjct: 20 GSGIPEVKAYLNGIDAHSILAPGTLFVKV 48 >ref|XP_017189314.1| PREDICTED: chloride channel protein CLC-c-like [Malus domestica] ref|XP_017186040.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Malus domestica] ref|XP_017186041.1| PREDICTED: chloride channel protein CLC-c-like isoform X1 [Malus domestica] Length = 189 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVKV Sbjct: 148 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 176 >ref|XP_020245643.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020245644.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020245645.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020245646.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020245647.1| chloride channel protein CLC-c-like [Asparagus officinalis] Length = 772 Score = 61.6 bits (148), Expect = 5e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKVR*TCCDFPPLYIL 128 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ + C ++L Sbjct: 161 GSGIPEVKAYLNGVDAHSILAPSTLFVKIVGSICGVSAGFVL 202 >ref|XP_020253001.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020253002.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020253003.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020253004.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020253005.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020253006.1| chloride channel protein CLC-c-like [Asparagus officinalis] ref|XP_020253007.1| chloride channel protein CLC-c-like [Asparagus officinalis] gb|ONK77356.1| uncharacterized protein A4U43_C02F5680 [Asparagus officinalis] Length = 772 Score = 61.6 bits (148), Expect = 5e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKVR*TCCDFPPLYIL 128 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ + C ++L Sbjct: 161 GSGIPEVKAYLNGVDAHSILAPSTLFVKIVGSICGVSAGFVL 202 >gb|ONK57742.1| uncharacterized protein A4U43_C09F3630 [Asparagus officinalis] Length = 780 Score = 61.6 bits (148), Expect = 5e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKVR*TCCDFPPLYIL 128 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ + C ++L Sbjct: 169 GSGIPEVKAYLNGVDAHSILAPSTLFVKIVGSICGVSAGFVL 210 >ref|XP_019703694.1| PREDICTED: chloride channel protein CLC-c-like [Elaeis guineensis] Length = 747 Score = 61.2 bits (147), Expect = 7e-08 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKVR*TCCDFPPLYIL 128 GSGIPEVKAYLNG+DAHSILAPSTLFVK+ + C ++L Sbjct: 136 GSGIPEVKAYLNGIDAHSILAPSTLFVKIFGSICGVSAGFVL 177 >gb|PON97512.1| Chloride channel, voltage gated [Trema orientalis] Length = 226 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNG+DAHSILAPSTLFVK+ Sbjct: 110 GSGIPEVKAYLNGIDAHSILAPSTLFVKI 138 >gb|PON71265.1| Chloride channel, voltage gated [Parasponia andersonii] Length = 228 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNG+DAHSILAPSTLFVK+ Sbjct: 112 GSGIPEVKAYLNGIDAHSILAPSTLFVKI 140 >ref|XP_017186042.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Malus domestica] Length = 181 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVK 86 GSGIPEVKAYLNGVDAHSILAPSTLFVK Sbjct: 148 GSGIPEVKAYLNGVDAHSILAPSTLFVK 175 >gb|PLY72094.1| hypothetical protein LSAT_9X121760 [Lactuca sativa] Length = 275 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 159 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 187 >ref|XP_021805092.1| chloride channel protein CLC-c-like [Prunus avium] Length = 348 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 133 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 161 >gb|OTG04782.1| putative chloride channel, voltage gated, Serine/threonine-protein kinase Plk3 [Helianthus annuus] Length = 409 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 37 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 65 >ref|XP_018817868.1| PREDICTED: chloride channel protein CLC-c isoform X2 [Juglans regia] Length = 630 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 20 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 48 >ref|XP_018502792.1| PREDICTED: chloride channel protein CLC-c-like isoform X2 [Pyrus x bretschneideri] Length = 630 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 20 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 48 >ref|XP_019171671.1| PREDICTED: chloride channel protein CLC-c isoform X2 [Ipomoea nil] ref|XP_019171672.1| PREDICTED: chloride channel protein CLC-c isoform X2 [Ipomoea nil] Length = 637 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 25 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 53 >gb|PHT41530.1| Chloride channel protein CLC-b, partial [Capsicum baccatum] Length = 643 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 33 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 61 >gb|ONI14593.1| hypothetical protein PRUPE_4G288000 [Prunus persica] gb|ONI14594.1| hypothetical protein PRUPE_4G288000 [Prunus persica] Length = 646 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 37 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 65 >ref|XP_020418158.1| chloride channel protein CLC-c isoform X2 [Prunus persica] Length = 647 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 38 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 66 >ref|XP_020261998.1| chloride channel protein CLC-c-like isoform X2 [Asparagus officinalis] Length = 651 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 GSGIPEVKAYLNGVDAHSILAPSTLFVKV 89 GSGIPEVKAYLNGVDAHSILAPSTLFVK+ Sbjct: 40 GSGIPEVKAYLNGVDAHSILAPSTLFVKI 68