BLASTX nr result
ID: Rehmannia32_contig00027125
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00027125 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020549649.1| calcium-dependent protein kinase 1-like [Ses... 148 7e-40 ref|XP_012835826.1| PREDICTED: calcium-dependent protein kinase ... 133 3e-37 gb|PIN07467.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 139 5e-36 gb|KZV28409.1| calcium-dependent protein kinase 26-like [Dorcoce... 134 4e-34 gb|EYU38709.1| hypothetical protein MIMGU_mgv1a002855mg [Erythra... 133 1e-33 ref|XP_009608538.1| PREDICTED: calcium-dependent protein kinase ... 129 2e-32 ref|XP_019257402.1| PREDICTED: calcium-dependent protein kinase ... 129 3e-32 ref|XP_022842422.1| calcium-dependent protein kinase 26-like [Ol... 129 3e-32 ref|XP_022883010.1| calcium-dependent protein kinase 1-like [Ole... 128 4e-32 ref|XP_016545797.1| PREDICTED: calcium-dependent protein kinase ... 128 6e-32 ref|XP_009787542.1| PREDICTED: calcium-dependent protein kinase ... 128 6e-32 ref|XP_022857805.1| calcium-dependent protein kinase 1-like [Ole... 124 6e-32 gb|PHT30719.1| Calcium-dependent protein kinase 2 [Capsicum bacc... 127 9e-32 ref|XP_008803232.1| PREDICTED: calcium-dependent protein kinase ... 127 1e-31 gb|KZM99184.1| hypothetical protein DCAR_013454 [Daucus carota s... 127 1e-31 ref|XP_017247529.1| PREDICTED: calcium-dependent protein kinase ... 127 2e-31 ref|XP_022940120.1| calcium-dependent protein kinase 26-like [Cu... 127 2e-31 ref|XP_023878100.1| calcium-dependent protein kinase 26-like [Qu... 127 2e-31 ref|XP_015900437.1| PREDICTED: calcium-dependent protein kinase ... 127 2e-31 gb|PHT99033.1| Calcium-dependent protein kinase 2 [Capsicum chin... 126 2e-31 >ref|XP_020549649.1| calcium-dependent protein kinase 1-like [Sesamum indicum] Length = 485 Score = 148 bits (373), Expect = 7e-40 Identities = 70/74 (94%), Positives = 71/74 (95%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQKACEEFGIED LEEMIRE DQNNDGRIDYNEFVAMMQKGNADFGKKRYQ Sbjct: 412 SGYITQDELQKACEEFGIEDVQLEEMIREADQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 471 Query: 195 NNFNIGFREAMPVY 154 NNFNIGFREAMPV+ Sbjct: 472 NNFNIGFREAMPVF 485 >ref|XP_012835826.1| PREDICTED: calcium-dependent protein kinase 1-like [Erythranthe guttata] Length = 155 Score = 133 bits (334), Expect = 3e-37 Identities = 63/73 (86%), Positives = 66/73 (90%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SG+ITQDELQKACEEFGIE+ HLEEMI EVDQNNDGRIDYNEFVAMMQKGN DFG+KR Q Sbjct: 82 SGFITQDELQKACEEFGIEELHLEEMILEVDQNNDGRIDYNEFVAMMQKGNTDFGRKRLQ 141 Query: 195 NNFNIGFREAMPV 157 N F IG REAMPV Sbjct: 142 NKFKIGIREAMPV 154 >gb|PIN07467.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 620 Score = 139 bits (350), Expect = 5e-36 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQKACEEFGIEDSHLEEMIRE D+NNDGRIDYNEFVAMMQKGN DFGKK++Q Sbjct: 546 SGYITQDELQKACEEFGIEDSHLEEMIREADENNDGRIDYNEFVAMMQKGNVDFGKKKFQ 605 Query: 195 NNFNIGFRE 169 NNFNIGFRE Sbjct: 606 NNFNIGFRE 614 >gb|KZV28409.1| calcium-dependent protein kinase 26-like [Dorcoceras hygrometricum] Length = 629 Score = 134 bits (337), Expect = 4e-34 Identities = 63/73 (86%), Positives = 66/73 (90%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQKACEEFGI D HLEE+I E DQNNDGRIDYNEFVAMMQKGNADFGKKR+Q Sbjct: 556 SGYITQDELQKACEEFGIADIHLEEIIGEADQNNDGRIDYNEFVAMMQKGNADFGKKRFQ 615 Query: 195 NNFNIGFREAMPV 157 +NFN GFRE PV Sbjct: 616 SNFNAGFREVTPV 628 >gb|EYU38709.1| hypothetical protein MIMGU_mgv1a002855mg [Erythranthe guttata] Length = 630 Score = 133 bits (334), Expect = 1e-33 Identities = 63/73 (86%), Positives = 66/73 (90%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SG+ITQDELQKACEEFGIE+ HLEEMI EVDQNNDGRIDYNEFVAMMQKGN DFG+KR Q Sbjct: 557 SGFITQDELQKACEEFGIEELHLEEMILEVDQNNDGRIDYNEFVAMMQKGNTDFGRKRLQ 616 Query: 195 NNFNIGFREAMPV 157 N F IG REAMPV Sbjct: 617 NKFKIGIREAMPV 629 >ref|XP_009608538.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana tomentosiformis] ref|XP_016482898.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana tabacum] Length = 610 Score = 129 bits (325), Expect = 2e-32 Identities = 62/73 (84%), Positives = 64/73 (87%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DELQKACEEFGIED HLEEMI+E DQ+NDGRIDYNEFVAMM KGNAD GK R Sbjct: 537 SGYITADELQKACEEFGIEDVHLEEMIQEADQDNDGRIDYNEFVAMMHKGNADLGKNRLP 596 Query: 195 NNFNIGFREAMPV 157 NNFNIGFREAM V Sbjct: 597 NNFNIGFREAMEV 609 >ref|XP_019257402.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana attenuata] ref|XP_019257403.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana attenuata] ref|XP_019257404.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana attenuata] gb|OIS96360.1| calcium-dependent protein kinase 1 [Nicotiana attenuata] Length = 604 Score = 129 bits (323), Expect = 3e-32 Identities = 61/73 (83%), Positives = 64/73 (87%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DELQKACEEFGIED HLEEMI+E DQ+NDGRIDYNEFVAMM KGNAD GKKR Sbjct: 531 SGYITADELQKACEEFGIEDVHLEEMIQEADQDNDGRIDYNEFVAMMHKGNADLGKKRLP 590 Query: 195 NNFNIGFREAMPV 157 NNFNIGFRE + V Sbjct: 591 NNFNIGFREVLEV 603 >ref|XP_022842422.1| calcium-dependent protein kinase 26-like [Olea europaea var. sylvestris] Length = 627 Score = 129 bits (323), Expect = 3e-32 Identities = 62/75 (82%), Positives = 65/75 (86%), Gaps = 1/75 (1%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT+DELQKAC EFG+ED HLEEMI+EVDQNNDGRIDYNEFV MM KGN D GKK Q Sbjct: 553 SGYITRDELQKACVEFGVEDDHLEEMIQEVDQNNDGRIDYNEFVDMMHKGNTDLGKKNLQ 612 Query: 195 -NNFNIGFREAMPVY 154 NN NIGFREAMPVY Sbjct: 613 NNNINIGFREAMPVY 627 >ref|XP_022883010.1| calcium-dependent protein kinase 1-like [Olea europaea var. sylvestris] Length = 620 Score = 128 bits (322), Expect = 4e-32 Identities = 59/73 (80%), Positives = 65/73 (89%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DELQKACEEFGI+D HLEEMIRE DQNNDG+IDYNEFV MM +G+ D G+KR Q Sbjct: 547 SGYITPDELQKACEEFGIKDVHLEEMIREADQNNDGQIDYNEFVVMMHRGDTDLGRKRLQ 606 Query: 195 NNFNIGFREAMPV 157 NNFNIGFREA+PV Sbjct: 607 NNFNIGFREAVPV 619 >ref|XP_016545797.1| PREDICTED: calcium-dependent protein kinase 26-like [Capsicum annuum] gb|PHT95465.1| Calcium-dependent protein kinase 2 [Capsicum annuum] Length = 606 Score = 128 bits (321), Expect = 6e-32 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DELQKACEEFGIED HLEE+I+E DQ+NDGRIDYNEFVAMM KGNAD GKKR Sbjct: 533 SGYITADELQKACEEFGIEDVHLEELIQEADQDNDGRIDYNEFVAMMHKGNADLGKKRLP 592 Query: 195 NNFNIGFREAM 163 NNFNIG+REAM Sbjct: 593 NNFNIGYREAM 603 >ref|XP_009787542.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana sylvestris] ref|XP_016479782.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana tabacum] ref|XP_016479783.1| PREDICTED: calcium-dependent protein kinase 26-like [Nicotiana tabacum] Length = 607 Score = 128 bits (321), Expect = 6e-32 Identities = 61/73 (83%), Positives = 64/73 (87%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DELQKACEEFGIED H EEMI+E DQ+NDGRIDYNEFVAMM KGNAD GKKR Sbjct: 534 SGYITADELQKACEEFGIEDVHWEEMIQEADQDNDGRIDYNEFVAMMHKGNADLGKKRLP 593 Query: 195 NNFNIGFREAMPV 157 NNFNIGFREA+ V Sbjct: 594 NNFNIGFREALEV 606 >ref|XP_022857805.1| calcium-dependent protein kinase 1-like [Olea europaea var. sylvestris] Length = 314 Score = 124 bits (310), Expect = 6e-32 Identities = 58/73 (79%), Positives = 64/73 (87%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DELQKACEEFGI+D H EEMIRE DQ+NDGRIDYNEFVAMMQKG+A+ G+KR Sbjct: 241 SGYITPDELQKACEEFGIKDVHFEEMIREADQDNDGRIDYNEFVAMMQKGDANLGRKRLH 300 Query: 195 NNFNIGFREAMPV 157 NNF+IG REA PV Sbjct: 301 NNFSIGIREATPV 313 >gb|PHT30719.1| Calcium-dependent protein kinase 2 [Capsicum baccatum] Length = 580 Score = 127 bits (319), Expect = 9e-32 Identities = 59/71 (83%), Positives = 64/71 (90%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DE+QKACEEFGIED HLEE+I+E DQ+NDGRIDYNEFVAMM KGNAD GKKR Sbjct: 507 SGYITADEIQKACEEFGIEDVHLEELIQEADQDNDGRIDYNEFVAMMHKGNADLGKKRLP 566 Query: 195 NNFNIGFREAM 163 NNFNIG+REAM Sbjct: 567 NNFNIGYREAM 577 >ref|XP_008803232.1| PREDICTED: calcium-dependent protein kinase 1 [Phoenix dactylifera] Length = 589 Score = 127 bits (319), Expect = 1e-31 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQ+ACEEFGIED LEEMIREVDQ+NDGRIDYNEFVAMMQKGNA FGKK Q Sbjct: 516 SGYITQDELQQACEEFGIEDVRLEEMIREVDQDNDGRIDYNEFVAMMQKGNAGFGKKGLQ 575 Query: 195 NNFNIGFREAM 163 N+F+IGFREA+ Sbjct: 576 NSFSIGFREAL 586 >gb|KZM99184.1| hypothetical protein DCAR_013454 [Daucus carota subsp. sativus] Length = 573 Score = 127 bits (318), Expect = 1e-31 Identities = 57/74 (77%), Positives = 69/74 (93%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQ+ACEEFGI+++ L+EMI+E DQNNDGRIDYNEFVAMMQKG+ D GK+R Q Sbjct: 500 SGYITQDELQQACEEFGIDNTQLDEMIKEADQNNDGRIDYNEFVAMMQKGDNDMGKRRLQ 559 Query: 195 NNFNIGFREAMPVY 154 +NF++GFREA+PVY Sbjct: 560 SNFSMGFREALPVY 573 >ref|XP_017247529.1| PREDICTED: calcium-dependent protein kinase 1-like [Daucus carota subsp. sativus] Length = 621 Score = 127 bits (318), Expect = 2e-31 Identities = 57/74 (77%), Positives = 69/74 (93%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQ+ACEEFGI+++ L+EMI+E DQNNDGRIDYNEFVAMMQKG+ D GK+R Q Sbjct: 548 SGYITQDELQQACEEFGIDNTQLDEMIKEADQNNDGRIDYNEFVAMMQKGDNDMGKRRLQ 607 Query: 195 NNFNIGFREAMPVY 154 +NF++GFREA+PVY Sbjct: 608 SNFSMGFREALPVY 621 >ref|XP_022940120.1| calcium-dependent protein kinase 26-like [Cucurbita moschata] Length = 638 Score = 127 bits (318), Expect = 2e-31 Identities = 62/74 (83%), Positives = 67/74 (90%), Gaps = 1/74 (1%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQKACE+FGIE HLEEMIREVDQ+NDGRIDYNEFVAMMQKGN D GKK Q Sbjct: 564 SGYITQDELQKACEDFGIESIHLEEMIREVDQDNDGRIDYNEFVAMMQKGNGDLGKKGQQ 623 Query: 195 N-NFNIGFREAMPV 157 + NF+IGFREA+PV Sbjct: 624 STNFSIGFREALPV 637 >ref|XP_023878100.1| calcium-dependent protein kinase 26-like [Quercus suber] Length = 640 Score = 127 bits (318), Expect = 2e-31 Identities = 59/73 (80%), Positives = 69/73 (94%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYITQDELQ+ACEEFGIED+HLEE+I+EVDQ+NDGRIDYNEFVAMMQKGNA GKK +Q Sbjct: 567 SGYITQDELQQACEEFGIEDAHLEEIIQEVDQDNDGRIDYNEFVAMMQKGNASLGKKGHQ 626 Query: 195 NNFNIGFREAMPV 157 ++F+IGFREA+ V Sbjct: 627 SSFSIGFREALSV 639 >ref|XP_015900437.1| PREDICTED: calcium-dependent protein kinase 26-like [Ziziphus jujuba] ref|XP_015871627.1| PREDICTED: calcium-dependent protein kinase 26-like [Ziziphus jujuba] Length = 646 Score = 127 bits (318), Expect = 2e-31 Identities = 62/74 (83%), Positives = 66/74 (89%), Gaps = 1/74 (1%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKK-RY 199 SGYITQDEL+KACEEFGIED HLEEMIREVDQ+NDGRIDYNEFVAMMQKGN D GKK + Sbjct: 572 SGYITQDELEKACEEFGIEDVHLEEMIREVDQDNDGRIDYNEFVAMMQKGNVDLGKKGLH 631 Query: 198 QNNFNIGFREAMPV 157 +F IGFREAMPV Sbjct: 632 STSFTIGFREAMPV 645 >gb|PHT99033.1| Calcium-dependent protein kinase 2 [Capsicum chinense] Length = 606 Score = 126 bits (317), Expect = 2e-31 Identities = 59/71 (83%), Positives = 63/71 (88%) Frame = -3 Query: 375 SGYITQDELQKACEEFGIEDSHLEEMIREVDQNNDGRIDYNEFVAMMQKGNADFGKKRYQ 196 SGYIT DELQKACEEFGIED HLEE+I+E DQ+NDGRIDYNEFVAMM KGNAD GKKR Sbjct: 533 SGYITADELQKACEEFGIEDVHLEELIQEADQDNDGRIDYNEFVAMMHKGNADLGKKRLP 592 Query: 195 NNFNIGFREAM 163 NNFN G+REAM Sbjct: 593 NNFNFGYREAM 603