BLASTX nr result
ID: Rehmannia32_contig00026451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00026451 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096763.1| F-box/kelch-repeat protein At3g06240-like [S... 75 1e-17 ref|XP_022850576.1| uncharacterized protein LOC111372460 [Olea e... 49 2e-07 >ref|XP_011096763.1| F-box/kelch-repeat protein At3g06240-like [Sesamum indicum] ref|XP_011096772.1| F-box/kelch-repeat protein At3g06240-like [Sesamum indicum] Length = 423 Score = 75.1 bits (183), Expect(2) = 1e-17 Identities = 35/52 (67%), Positives = 40/52 (76%) Frame = -2 Query: 158 KGSLNKNRKKQHCENEPQDSFVVVPEIPDECIFDIIVRLPIESLPTSRFVCK 3 K L +N+KKQH EPQD V VP +P +CIFDIIVRLP+ESL TSRFVCK Sbjct: 24 KRELEENQKKQHWNKEPQDILVSVPYLPKDCIFDIIVRLPLESLQTSRFVCK 75 Score = 42.0 bits (97), Expect(2) = 1e-17 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -1 Query: 228 MNTKSMVVKATSLLKLVEQRIQSKRELEQ 142 MNTK +V K TSLL+LVE+RI+ KRELE+ Sbjct: 1 MNTKPLVSKTTSLLRLVEERIKLKRELEE 29 >ref|XP_022850576.1| uncharacterized protein LOC111372460 [Olea europaea var. sylvestris] Length = 421 Score = 48.9 bits (115), Expect(2) = 2e-07 Identities = 21/45 (46%), Positives = 31/45 (68%) Frame = -2 Query: 137 RKKQHCENEPQDSFVVVPEIPDECIFDIIVRLPIESLPTSRFVCK 3 R+ +H + Q+S V++P +P +CI I+V LP+ESL RFVCK Sbjct: 23 REVEHERKKQQESLVIIPYLPKDCISKILVLLPLESLQKLRFVCK 67 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -1 Query: 228 MNTKSMVVKATSLLKLVEQRIQSKRELEQ 142 MNTKS+ K SLLKLVE+RIQ + E E+ Sbjct: 1 MNTKSVDGKGASLLKLVEERIQREVEHER 29