BLASTX nr result
ID: Rehmannia32_contig00026260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00026260 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIS99663.1| hypothetical protein A4A49_09365 [Nicotiana atten... 48 1e-10 >gb|OIS99663.1| hypothetical protein A4A49_09365 [Nicotiana attenuata] Length = 509 Score = 47.8 bits (112), Expect(2) = 1e-10 Identities = 24/50 (48%), Positives = 27/50 (54%) Frame = +2 Query: 218 LNESSFGEAYXXXXXXXXXXXXXXPARPSYMGNSYNSYEGHTQNRGGMRT 367 L SSF EAY PARP+YM NSY SY+GH Q RG R+ Sbjct: 287 LTHSSFDEAYGNDGARGRSSQSKSPARPAYMSNSYYSYDGHGQGRGIYRS 336 Score = 45.8 bits (107), Expect(2) = 1e-10 Identities = 28/74 (37%), Positives = 37/74 (50%) Frame = +3 Query: 6 RARGKFLGSSVMFDSDITFVVVLN*KGWSPKMNFFIESISSLVCPRWIH*ADLRLCHDKA 185 +ARGKF SS++FDSD+TF+V+L CH KA Sbjct: 249 QARGKFF-SSILFDSDVTFLVIL--------------------------------CHVKA 275 Query: 186 ATILRDLEWKCLTN 227 A I+R L+WKCLT+ Sbjct: 276 AIIVRVLQWKCLTH 289