BLASTX nr result
ID: Rehmannia32_contig00026182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00026182 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020554032.1| nuclear inhibitor of protein phosphatase 1 [... 59 1e-07 ref|XP_011086286.1| nuclear inhibitor of protein phosphatase 1 [... 55 3e-06 >ref|XP_020554032.1| nuclear inhibitor of protein phosphatase 1 [Sesamum indicum] Length = 429 Score = 58.9 bits (141), Expect = 1e-07 Identities = 34/58 (58%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = -1 Query: 364 DLYGDSLSVKVGSSWAYTS-GRGDSPSKNEGNNPRGELVKSESNLAXXXXXXXXDLFG 194 DLYG++ SVKVGSSWAY S GR SPSK+ GN P E K ESN A DLFG Sbjct: 372 DLYGEAFSVKVGSSWAYGSGGREASPSKSGGNTPGSESEKCESNSANNVNDNDDDLFG 429 >ref|XP_011086286.1| nuclear inhibitor of protein phosphatase 1 [Sesamum indicum] Length = 429 Score = 55.1 bits (131), Expect = 3e-06 Identities = 33/61 (54%), Positives = 35/61 (57%), Gaps = 4/61 (6%) Frame = -1 Query: 364 DLYGDSLSVKVGSSWAYTS----GRGDSPSKNEGNNPRGELVKSESNLAXXXXXXXXDLF 197 DLYG+S S KVGSSWAYTS GR SP+K GN P E KSES DLF Sbjct: 369 DLYGESFSTKVGSSWAYTSVESGGREASPTKIGGNTPGSEHEKSESRSGNNEDDNDDDLF 428 Query: 196 G 194 G Sbjct: 429 G 429