BLASTX nr result
ID: Rehmannia32_contig00026157
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00026157 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABS03794.1| hypothetical protein Krad_2313 [Kineococcus radio... 52 4e-06 >gb|ABS03794.1| hypothetical protein Krad_2313 [Kineococcus radiotolerans SRS30216 = ATCC BAA-149] Length = 122 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +1 Query: 148 RAFCFLIRAHCSLIRAPCSLIRAPCSAINFSTSINSFRCSLI-TPWSTCFFPITLKYIDG 324 RA C ++RA CS++RAPCS++RAPCS + S+ CS++ P S P ++ G Sbjct: 38 RAPCSVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRAPCSVLRASG 97 Query: 325 VTCSPRPLTRP 357 P ++ P Sbjct: 98 TDAGPDEVSEP 108