BLASTX nr result
ID: Rehmannia32_contig00026092
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00026092 (526 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64827.1| hypothetical protein [Beta vulgaris] 40 4e-06 >dbj|BAM64827.1| hypothetical protein [Beta vulgaris] Length = 2403 Score = 40.4 bits (93), Expect(2) = 4e-06 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -2 Query: 159 PKAGEVKSCVWENVPFKWQINDSNIDCGVFLMHNMKIFVGKVYSSLDLSK 10 P A V +E F W+ + SN DCGVFL+H+M+ + G + ++ L K Sbjct: 2263 PNAELVPHYKFEVQEFDWKSSKSNNDCGVFLIHHMQFYEGTKFDNVHLMK 2312 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -1 Query: 382 WMSTLNKP-NLNNVGRIFVPYCYQSHFIATFINFVDKKVQYLDNLVHDEEVVDHYVGLS 209 W+++ N ++ I+VP Y+ H+I I+ + +KV YLDN + EE + + LS Sbjct: 2188 WVTSFNSGCDIFVANLIYVPVLYEDHYILFVIDHLKQKVHYLDNRIWGEEKIATFRDLS 2246