BLASTX nr result
ID: Rehmannia32_contig00026050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00026050 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020548472.1| pentatricopeptide repeat-containing protein ... 77 9e-13 gb|PIN07104.1| hypothetical protein CDL12_20332 [Handroanthus im... 76 1e-12 ref|XP_012856600.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_012856599.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_020548472.1| pentatricopeptide repeat-containing protein At5g50990 [Sesamum indicum] Length = 547 Score = 76.6 bits (187), Expect = 9e-13 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = -2 Query: 160 MEVMRRKLFSLGSPFRWSHTAIFNPKLEINVASPQTVYSITDDQKLFSILESC 2 MEV+RR+L S GS RWSHT IF P+ VASPQT+YS++DDQKLF ILESC Sbjct: 1 MEVVRRRLVSPGSSLRWSHTTIFTPRPYSTVASPQTLYSVSDDQKLFRILESC 53 >gb|PIN07104.1| hypothetical protein CDL12_20332 [Handroanthus impetiginosus] Length = 546 Score = 76.3 bits (186), Expect = 1e-12 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = -2 Query: 160 MEVMRRKLFSLGSPFRWSHTAIFNPKLEINVASPQTVYSITDDQKLFSILESC 2 MEV+R+ LFSL SPFRWSH AIF+PK + SPQT+YSIT D+ +F ILESC Sbjct: 1 MEVLRKGLFSLRSPFRWSHIAIFSPKYHSFIGSPQTLYSITGDETIFHILESC 53 >ref|XP_012856600.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 isoform X2 [Erythranthe guttata] Length = 551 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -2 Query: 151 MRRKLFSLGSPFRWSHTAIFNPKLEINVASPQTVYSITDDQKLFSILESC 2 +RR+L S PFR HTA+F PK VASPQ +Y ITDD+ LF+ILESC Sbjct: 9 LRRRLLSPVPPFRRRHTAVFTPKPHPTVASPQNIYPITDDRVLFAILESC 58 >ref|XP_012856599.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 isoform X1 [Erythranthe guttata] Length = 554 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 3/53 (5%) Frame = -2 Query: 151 MRRKLFSLGSPFRWSHTAIFNPKLEINVASPQTVYSIT---DDQKLFSILESC 2 +RR+L S PFR HTA+F PK VASPQ +Y IT DD+ LF+ILESC Sbjct: 9 LRRRLLSPVPPFRRRHTAVFTPKPHPTVASPQNIYPITEYEDDRVLFAILESC 61