BLASTX nr result
ID: Rehmannia32_contig00025944
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025944 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101318.1| RNA polymerase I termination factor [Sesamum... 80 6e-15 gb|EYU17677.1| hypothetical protein MIMGU_mgv1a003135mg [Erythra... 66 5e-10 ref|XP_012829324.1| PREDICTED: cyclin-D-binding Myb-like transcr... 66 5e-10 >ref|XP_011101318.1| RNA polymerase I termination factor [Sesamum indicum] Length = 736 Score = 79.7 bits (195), Expect = 6e-15 Identities = 44/84 (52%), Positives = 57/84 (67%), Gaps = 2/84 (2%) Frame = -1 Query: 253 FETGSCKEVEGNESDKRMNGESFSGMKSSREAKIERKKGKAKINTEDGEFEREID--GKE 80 FE G+ VEGNES+K GES S KS +EAK ERK KA N DG+ E+E GK Sbjct: 129 FERGNTVHVEGNESEKLPEGESISRKKSHKEAKKERKNQKALRNRGDGDIEKEGGKYGKG 188 Query: 79 VGTQSQNCEVHAMEMVERKKRKKD 8 GT S++C+V+ M++VERKKRK++ Sbjct: 189 EGTGSEHCKVNDMDLVERKKRKRE 212 >gb|EYU17677.1| hypothetical protein MIMGU_mgv1a003135mg [Erythranthe guttata] Length = 605 Score = 65.9 bits (159), Expect = 5e-10 Identities = 42/83 (50%), Positives = 52/83 (62%), Gaps = 1/83 (1%) Frame = -1 Query: 253 FETGSCKEVEGNESDKRMNGESFSGMKSSREAKIERKKGKAKINTEDGEFERE-IDGKEV 77 FETG KEVEG ES + GES SG S+ ERK K K N ++G+ E+E DG EV Sbjct: 121 FETGINKEVEGKESKRWSEGESVSGTTCSK----ERKTKKPKRNHDNGDSEKEKEDGNEV 176 Query: 76 GTQSQNCEVHAMEMVERKKRKKD 8 GT+ QN ++ VERKKRKK+ Sbjct: 177 GTRKQNSKI----PVERKKRKKE 195 >ref|XP_012829324.1| PREDICTED: cyclin-D-binding Myb-like transcription factor 1 [Erythranthe guttata] Length = 627 Score = 65.9 bits (159), Expect = 5e-10 Identities = 42/83 (50%), Positives = 52/83 (62%), Gaps = 1/83 (1%) Frame = -1 Query: 253 FETGSCKEVEGNESDKRMNGESFSGMKSSREAKIERKKGKAKINTEDGEFERE-IDGKEV 77 FETG KEVEG ES + GES SG S+ ERK K K N ++G+ E+E DG EV Sbjct: 121 FETGINKEVEGKESKRWSEGESVSGTTCSK----ERKTKKPKRNHDNGDSEKEKEDGNEV 176 Query: 76 GTQSQNCEVHAMEMVERKKRKKD 8 GT+ QN ++ VERKKRKK+ Sbjct: 177 GTRKQNSKI----PVERKKRKKE 195