BLASTX nr result
ID: Rehmannia32_contig00025475
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025475 (343 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020548041.1| pentatricopeptide repeat-containing protein ... 100 5e-22 gb|OAY53247.1| hypothetical protein MANES_04G148100 [Manihot esc... 80 4e-15 ref|XP_021609850.1| pentatricopeptide repeat-containing protein ... 80 4e-15 ref|XP_018811520.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-15 ref|XP_021609848.1| pentatricopeptide repeat-containing protein ... 80 4e-15 ref|XP_021609829.1| pentatricopeptide repeat-containing protein ... 80 4e-15 ref|XP_017178041.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-14 ref|XP_008392359.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-14 ref|XP_022155166.1| pentatricopeptide repeat-containing protein ... 77 7e-14 ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-13 ref|XP_022845009.1| putative pentatricopeptide repeat-containing... 76 1e-13 gb|KZV31567.1| pentatricopeptide repeat-containing protein [Dorc... 75 2e-13 ref|XP_017973975.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-13 ref|XP_018501005.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-13 gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein... 75 3e-13 gb|KCW88422.1| hypothetical protein EUGRSUZ_A00809 [Eucalyptus g... 74 4e-13 ref|XP_010044040.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-13 ref|XP_002527661.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-13 ref|XP_021296182.1| pentatricopeptide repeat-containing protein ... 74 6e-13 gb|OMO77343.1| hypothetical protein CCACVL1_15065 [Corchorus cap... 74 6e-13 >ref|XP_020548041.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Sesamum indicum] ref|XP_020548042.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Sesamum indicum] Length = 742 Score = 99.8 bits (247), Expect = 5e-22 Identities = 48/68 (70%), Positives = 55/68 (80%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+NRMD A ML DEM + +CPD ITYSVL+RG QKLG+VD A+QLLNEMKNRG+ Sbjct: 675 DGFCKVNRMDMANMLVDEMNKNTICPDQITYSVLIRGCQKLGYVDSARQLLNEMKNRGIR 734 Query: 181 PDGSTLKT 204 P STLKT Sbjct: 735 PCESTLKT 742 >gb|OAY53247.1| hypothetical protein MANES_04G148100 [Manihot esculenta] Length = 726 Score = 80.1 bits (196), Expect = 4e-15 Identities = 37/71 (52%), Positives = 50/71 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+ RMD A +L DEM + NV PD++TY+ L+ GYQ+LG+ DKAQ L +EMK +G++ Sbjct: 635 DGFCKLKRMDMANLLMDEMKRNNVKPDVLTYTALISGYQRLGYGDKAQGLFDEMKEKGIV 694 Query: 181 PDGSTLKT*GR 213 PD GR Sbjct: 695 PDHIAYAASGR 705 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/62 (38%), Positives = 40/62 (64%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF ++ M +A L+ EM+Q+ P+++TY+ L+ G+ KL +D A L++EMK + Sbjct: 600 DGFCRVENMKRAWALYKEMLQQGQSPNVVTYTCLIDGFCKLKRMDMANLLMDEMKRNNVK 659 Query: 181 PD 186 PD Sbjct: 660 PD 661 >ref|XP_021609850.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X3 [Manihot esculenta] Length = 728 Score = 80.1 bits (196), Expect = 4e-15 Identities = 37/71 (52%), Positives = 50/71 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+ RMD A +L DEM + NV PD++TY+ L+ GYQ+LG+ DKAQ L +EMK +G++ Sbjct: 635 DGFCKLKRMDMANLLMDEMKRNNVKPDVLTYTALISGYQRLGYGDKAQGLFDEMKEKGIV 694 Query: 181 PDGSTLKT*GR 213 PD GR Sbjct: 695 PDHIAYAASGR 705 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/62 (38%), Positives = 40/62 (64%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF ++ M +A L+ EM+Q+ P+++TY+ L+ G+ KL +D A L++EMK + Sbjct: 600 DGFCRVENMKRAWALYKEMLQQGQSPNVVTYTCLIDGFCKLKRMDMANLLMDEMKRNNVK 659 Query: 181 PD 186 PD Sbjct: 660 PD 661 >ref|XP_018811520.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811521.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811522.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811523.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811524.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811525.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811526.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811527.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] ref|XP_018811529.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Juglans regia] Length = 749 Score = 80.1 bits (196), Expect = 4e-15 Identities = 33/67 (49%), Positives = 53/67 (79%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+NRMD A +L DEM + V PD++TY+VL+ GY +LG++++A++L +EMK+ G++ Sbjct: 667 DGFCKVNRMDMADLLVDEMKRNKVTPDVVTYTVLIIGYHRLGNIERARELFDEMKSSGII 726 Query: 181 PDGSTLK 201 PD + L+ Sbjct: 727 PDDTALR 733 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/58 (39%), Positives = 41/58 (70%) Frame = +1 Query: 4 GFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGL 177 GF K+ +DKA +F+ M+ V P+ +TY+V++ GY K GH+++A +L+ EM++ G+ Sbjct: 458 GFCKLGFLDKAMEVFNIMLHHGVLPNTVTYNVIIDGYCKEGHLEEALKLMAEMQDLGI 515 >ref|XP_021609848.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X2 [Manihot esculenta] ref|XP_021609849.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X2 [Manihot esculenta] Length = 755 Score = 80.1 bits (196), Expect = 4e-15 Identities = 37/71 (52%), Positives = 50/71 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+ RMD A +L DEM + NV PD++TY+ L+ GYQ+LG+ DKAQ L +EMK +G++ Sbjct: 664 DGFCKLKRMDMANLLMDEMKRNNVKPDVLTYTALISGYQRLGYGDKAQGLFDEMKEKGIV 723 Query: 181 PDGSTLKT*GR 213 PD GR Sbjct: 724 PDHIAYAASGR 734 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/62 (38%), Positives = 40/62 (64%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF ++ M +A L+ EM+Q+ P+++TY+ L+ G+ KL +D A L++EMK + Sbjct: 629 DGFCRVENMKRAWALYKEMLQQGQSPNVVTYTCLIDGFCKLKRMDMANLLMDEMKRNNVK 688 Query: 181 PD 186 PD Sbjct: 689 PD 690 >ref|XP_021609829.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609830.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609831.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609832.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609833.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609834.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609835.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609836.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609837.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609838.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609839.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609840.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609842.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609843.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609844.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609845.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609846.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] ref|XP_021609847.1| pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like isoform X1 [Manihot esculenta] Length = 757 Score = 80.1 bits (196), Expect = 4e-15 Identities = 37/71 (52%), Positives = 50/71 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+ RMD A +L DEM + NV PD++TY+ L+ GYQ+LG+ DKAQ L +EMK +G++ Sbjct: 664 DGFCKLKRMDMANLLMDEMKRNNVKPDVLTYTALISGYQRLGYGDKAQGLFDEMKEKGIV 723 Query: 181 PDGSTLKT*GR 213 PD GR Sbjct: 724 PDHIAYAASGR 734 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/62 (38%), Positives = 40/62 (64%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF ++ M +A L+ EM+Q+ P+++TY+ L+ G+ KL +D A L++EMK + Sbjct: 629 DGFCRVENMKRAWALYKEMLQQGQSPNVVTYTCLIDGFCKLKRMDMANLLMDEMKRNNVK 688 Query: 181 PD 186 PD Sbjct: 689 PD 690 >ref|XP_017178041.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like isoform X2 [Malus domestica] Length = 671 Score = 77.0 bits (188), Expect = 5e-14 Identities = 39/70 (55%), Positives = 49/70 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K RMD A LFDEM +KNV PD +TY+VL+ GY +LG++D+A QL EMK RG+ Sbjct: 593 DGFCKSLRMDFASFLFDEMKRKNVIPDAVTYTVLMIGYFRLGNIDRAIQLFGEMKERGIS 652 Query: 181 PDGSTLKT*G 210 PD +T G Sbjct: 653 PDVIAQETMG 662 >ref|XP_008392359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_008392360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_008392361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_017178039.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_017178040.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] Length = 673 Score = 77.0 bits (188), Expect = 5e-14 Identities = 39/70 (55%), Positives = 49/70 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K RMD A LFDEM +KNV PD +TY+VL+ GY +LG++D+A QL EMK RG+ Sbjct: 593 DGFCKSLRMDFASFLFDEMKRKNVIPDAVTYTVLMIGYFRLGNIDRAIQLFGEMKERGIS 652 Query: 181 PDGSTLKT*G 210 PD +T G Sbjct: 653 PDVIAQETMG 662 >ref|XP_022155166.1| pentatricopeptide repeat-containing protein At1g63330-like [Momordica charantia] ref|XP_022155167.1| pentatricopeptide repeat-containing protein At1g63330-like [Momordica charantia] ref|XP_022155168.1| pentatricopeptide repeat-containing protein At1g63330-like [Momordica charantia] ref|XP_022155170.1| pentatricopeptide repeat-containing protein At1g63330-like [Momordica charantia] ref|XP_022155171.1| pentatricopeptide repeat-containing protein At1g63330-like [Momordica charantia] ref|XP_022155172.1| pentatricopeptide repeat-containing protein At1g63330-like [Momordica charantia] ref|XP_022155173.1| pentatricopeptide repeat-containing protein At1g63330-like [Momordica charantia] Length = 748 Score = 76.6 bits (187), Expect = 7e-14 Identities = 35/70 (50%), Positives = 51/70 (72%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+ R+D A L D+M + N+ PD+ITY+VL+ GY +LG ++KA +L +EM+ G+L Sbjct: 667 DGFCKLKRLDLASFLVDDMKRANLTPDVITYTVLIAGYLRLGKIEKAHELFDEMRADGIL 726 Query: 181 PDGSTLKT*G 210 PD TL+T G Sbjct: 727 PDDVTLQTLG 736 >ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_010663283.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_010663291.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_010663306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_019080195.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_019080198.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] ref|XP_019080200.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330 [Vitis vinifera] emb|CBI33854.3| unnamed protein product, partial [Vitis vinifera] Length = 767 Score = 75.9 bits (185), Expect = 1e-13 Identities = 33/65 (50%), Positives = 50/65 (76%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DG+ K+NR+D A ML DEM +K + PD++TY+VL+ +++ G++DKA ++LNEMK G+L Sbjct: 683 DGYCKMNRIDIADMLIDEMKRKGITPDVVTYNVLIAAHRRRGNLDKALEMLNEMKENGVL 742 Query: 181 PDGST 195 PD T Sbjct: 743 PDHMT 747 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/61 (45%), Positives = 41/61 (67%) Frame = +1 Query: 4 GFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLLP 183 GF +I M KA LF+EM+Q+ P ++TY+ LV GY K+ +D A L++EMK +G+ P Sbjct: 649 GFCRIGDMRKAWALFNEMLQRGHLPTVVTYTSLVDGYCKMNRIDIADMLIDEMKRKGITP 708 Query: 184 D 186 D Sbjct: 709 D 709 >ref|XP_022845009.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845010.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845011.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845012.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845013.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845014.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845015.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845016.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845018.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] Length = 801 Score = 75.9 bits (185), Expect = 1e-13 Identities = 36/70 (51%), Positives = 49/70 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K+N+M ML +EM ++NVCPD +TY VL+ GY ++G VDKA +L ++M G L Sbjct: 723 DGFCKVNQMVLVNMLVEEMRRENVCPDWVTYLVLISGYLRVGFVDKAHKLFDKMIKEGGL 782 Query: 181 PDGSTLKT*G 210 PD T+KT G Sbjct: 783 PDDITIKTLG 792 >gb|KZV31567.1| pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 598 Score = 75.5 bits (184), Expect = 2e-13 Identities = 35/67 (52%), Positives = 48/67 (71%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF+K+NR+D ML +EM K + PD +TYSVL+RGYQ+LG VD+AQ +E + RG++ Sbjct: 519 DGFFKVNRIDMVIMLVEEMSYKEIYPDPVTYSVLIRGYQQLGFVDRAQHSYDEARRRGVV 578 Query: 181 PDGSTLK 201 D T K Sbjct: 579 LDKFTSK 585 >ref|XP_017973975.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] ref|XP_017973976.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial [Theobroma cacao] Length = 746 Score = 75.1 bits (183), Expect = 2e-13 Identities = 31/70 (44%), Positives = 51/70 (72%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF I+RMD A +L DEM ++++ PD++TY+ L+ GY++LG +D+A +L EMK++G++ Sbjct: 668 DGFCHIHRMDMANLLIDEMKRRDINPDVVTYTALISGYRRLGDIDRAHELFAEMKSKGIV 727 Query: 181 PDGSTLKT*G 210 PD + G Sbjct: 728 PDDAAYSALG 737 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/64 (42%), Positives = 41/64 (64%) Frame = +1 Query: 4 GFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLLP 183 GF K+ +DKA LF+ M+Q V P + T +V+ GY K GH+++A +L+NEM G+ P Sbjct: 460 GFCKMGLLDKALELFNIMLQSGVSPTIFTCNVIADGYCKAGHLEEALKLINEMHEFGIFP 519 Query: 184 DGST 195 + T Sbjct: 520 NSYT 523 >ref|XP_018501005.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Pyrus x bretschneideri] ref|XP_018501006.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62914, mitochondrial-like [Pyrus x bretschneideri] Length = 671 Score = 74.7 bits (182), Expect = 3e-13 Identities = 38/70 (54%), Positives = 48/70 (68%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF K RMD A LFDEM +KNV PD +TY+VL+ GY +LG++D+A QL EMK R + Sbjct: 593 DGFCKSFRMDCASFLFDEMKRKNVIPDAVTYTVLMIGYFRLGNIDRAIQLFGEMKERSIS 652 Query: 181 PDGSTLKT*G 210 PD +T G Sbjct: 653 PDVIAQETMG 662 >gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 746 Score = 74.7 bits (182), Expect = 3e-13 Identities = 31/70 (44%), Positives = 50/70 (71%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF I+RMD A +L DEM ++ + PD++TY+ L+ GY++LG +D+A +L EMK++G++ Sbjct: 668 DGFCHIHRMDMANLLIDEMKRREINPDVVTYTALISGYRRLGDIDRAHELFAEMKSKGIV 727 Query: 181 PDGSTLKT*G 210 PD + G Sbjct: 728 PDDAAYSALG 737 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/64 (42%), Positives = 41/64 (64%) Frame = +1 Query: 4 GFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLLP 183 GF K+ +DKA LF+ M+Q V P + T +V+ GY K GH+++A +L+NEM G+ P Sbjct: 460 GFCKMGLLDKALELFNIMLQSGVSPTIFTCNVIADGYCKAGHLEEALKLINEMHEFGIFP 519 Query: 184 DGST 195 + T Sbjct: 520 NSYT 523 >gb|KCW88422.1| hypothetical protein EUGRSUZ_A00809 [Eucalyptus grandis] gb|KCW88423.1| hypothetical protein EUGRSUZ_A00809 [Eucalyptus grandis] Length = 589 Score = 74.3 bits (181), Expect = 4e-13 Identities = 32/66 (48%), Positives = 52/66 (78%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 +G K+ RMDK++MLF EM+Q+ + PD+ITY+ LV G+ +G+++ A++L+NEM++RGL Sbjct: 367 NGHCKVKRMDKSKMLFQEMLQRGLIPDVITYNTLVNGFCLVGNLEAAEELINEMQSRGLS 426 Query: 181 PDGSTL 198 P+ TL Sbjct: 427 PNHYTL 432 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/68 (36%), Positives = 42/68 (61%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 +G+ NRM KA + + M+++ P ++TY+ L+ G+ K+ +DK++ L EM RGL+ Sbjct: 332 NGYCLQNRMKKAMEVLNLMVERGCSPTVVTYNTLINGHCKVKRMDKSKMLFQEMLQRGLI 391 Query: 181 PDGSTLKT 204 PD T T Sbjct: 392 PDVITYNT 399 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/68 (39%), Positives = 43/68 (63%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 +G ++D AR LFD + + + P++ TY++L+RG K G +++A +LL EM+ G L Sbjct: 472 NGMCNAGKLDDARGLFDCLHARGLQPNVWTYNILMRGLCKGGCMEEAYRLLKEMQENGCL 531 Query: 181 PDGSTLKT 204 PDG T T Sbjct: 532 PDGVTYNT 539 >ref|XP_010044040.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial [Eucalyptus grandis] ref|XP_010044048.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial [Eucalyptus grandis] ref|XP_018727656.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial [Eucalyptus grandis] ref|XP_018727668.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial [Eucalyptus grandis] Length = 675 Score = 74.3 bits (181), Expect = 4e-13 Identities = 32/66 (48%), Positives = 52/66 (78%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 +G K+ RMDK++MLF EM+Q+ + PD+ITY+ LV G+ +G+++ A++L+NEM++RGL Sbjct: 453 NGHCKVKRMDKSKMLFQEMLQRGLIPDVITYNTLVNGFCLVGNLEAAEELINEMQSRGLS 512 Query: 181 PDGSTL 198 P+ TL Sbjct: 513 PNHYTL 518 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/68 (36%), Positives = 42/68 (61%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 +G+ NRM KA + + M+++ P ++TY+ L+ G+ K+ +DK++ L EM RGL+ Sbjct: 418 NGYCLQNRMKKAMEVLNLMVERGCSPTVVTYNTLINGHCKVKRMDKSKMLFQEMLQRGLI 477 Query: 181 PDGSTLKT 204 PD T T Sbjct: 478 PDVITYNT 485 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/68 (39%), Positives = 43/68 (63%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 +G ++D AR LFD + + + P++ TY++L+RG K G +++A +LL EM+ G L Sbjct: 558 NGMCNAGKLDDARGLFDCLHARGLQPNVWTYNILMRGLCKGGCMEEAYRLLKEMQENGCL 617 Query: 181 PDGSTLKT 204 PDG T T Sbjct: 618 PDGVTYNT 625 >ref|XP_002527661.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial [Ricinus communis] ref|XP_015579953.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial [Ricinus communis] ref|XP_015579954.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial [Ricinus communis] gb|EEF34732.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 766 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/70 (47%), Positives = 49/70 (70%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DG++KI RMDKA LF++M + NV PD +TY+ L+ GYQ LG+ D+ +++ NEMK G+ Sbjct: 681 DGYFKIKRMDKADFLFNKMKRDNVTPDGLTYTALIFGYQSLGYSDRVREMFNEMKENGVF 740 Query: 181 PDGSTLKT*G 210 P+ + T G Sbjct: 741 PNYTAYATLG 750 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/64 (42%), Positives = 39/64 (60%) Frame = +1 Query: 4 GFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLLP 183 GF K+ M A L++EM Q P+++TY+ L+ GY K+ +DKA L N+MK + P Sbjct: 647 GFCKVGDMKSAWALYEEMSQWGKSPNVVTYTCLIDGYFKIKRMDKADFLFNKMKRDNVTP 706 Query: 184 DGST 195 DG T Sbjct: 707 DGLT 710 >ref|XP_021296182.1| pentatricopeptide repeat-containing protein At5g39710-like [Herrania umbratica] ref|XP_021296190.1| pentatricopeptide repeat-containing protein At5g39710-like [Herrania umbratica] ref|XP_021296198.1| pentatricopeptide repeat-containing protein At5g39710-like [Herrania umbratica] Length = 746 Score = 73.9 bits (180), Expect = 6e-13 Identities = 30/70 (42%), Positives = 50/70 (71%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF ++RMD A +L DEM ++ + PD++TY+ L+ GY++LG +D+A +L EMK++G++ Sbjct: 668 DGFCHLHRMDMANLLIDEMKRREINPDVVTYTALISGYKRLGDIDRAHELFAEMKSKGIV 727 Query: 181 PDGSTLKT*G 210 PD + G Sbjct: 728 PDDAAYSALG 737 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/64 (40%), Positives = 40/64 (62%) Frame = +1 Query: 4 GFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLLP 183 GF K+ +DKA LF M+Q V P++ T +V+ GY K GH+++A +L+N M G+ P Sbjct: 460 GFCKMGLLDKALELFKIMLQSGVSPNIFTCNVIADGYCKAGHLEEALKLINGMHEFGIFP 519 Query: 184 DGST 195 + T Sbjct: 520 NSYT 523 >gb|OMO77343.1| hypothetical protein CCACVL1_15065 [Corchorus capsularis] Length = 1517 Score = 73.9 bits (180), Expect = 6e-13 Identities = 31/62 (50%), Positives = 46/62 (74%) Frame = +1 Query: 1 DGFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLL 180 DGF I RMD A +L DEM ++ + PD++TY+ L+ GY+KLG +D A +L +EMK +G++ Sbjct: 1441 DGFCHIKRMDMANLLIDEMKRQEIKPDVVTYTALISGYKKLGDIDLAHELFDEMKRKGIV 1500 Query: 181 PD 186 PD Sbjct: 1501 PD 1502 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/64 (39%), Positives = 41/64 (64%) Frame = +1 Query: 4 GFYKINRMDKARMLFDEMIQKNVCPDLITYSVLVRGYQKLGHVDKAQQLLNEMKNRGLLP 183 GF + +DKA LF M+Q V P L T++V+ GY ++G++++A +L+NEM G+ P Sbjct: 1233 GFCETGLLDKALELFSIMLQCGVLPTLFTFNVIADGYCRVGYLEEALKLINEMHEFGIFP 1292 Query: 184 DGST 195 + T Sbjct: 1293 NSYT 1296