BLASTX nr result
ID: Rehmannia32_contig00025381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025381 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43199.1| hypothetical protein MIMGU_mgv1a0198182mg, partia... 52 7e-06 >gb|EYU43199.1| hypothetical protein MIMGU_mgv1a0198182mg, partial [Erythranthe guttata] Length = 64 Score = 52.0 bits (123), Expect = 7e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -2 Query: 149 NELTHFPSVQLNIHNLVVPLNQGLGISNSQGWVTAMN 39 N +F + LN HNLVVPLNQ LGISN QGWVT M+ Sbjct: 7 NGRNYFQVLDLNFHNLVVPLNQDLGISNLQGWVTIMD 43