BLASTX nr result
ID: Rehmannia32_contig00025353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025353 (277 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022849761.1| uncharacterized protein LOC111371818 [Olea e... 56 4e-07 >ref|XP_022849761.1| uncharacterized protein LOC111371818 [Olea europaea var. sylvestris] Length = 437 Score = 56.2 bits (134), Expect = 4e-07 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = +2 Query: 122 MRRGANGTDXXXXXXXXXXXXXXXXXRGPHDSVQKRRWGSCLSLYSCFGSNK 277 MRRG NGTD R P S+QKRRWGSC SLY CFGS+K Sbjct: 1 MRRGVNGTDVLETINAAATAISLNENRFPQSSIQKRRWGSCWSLYWCFGSHK 52