BLASTX nr result
ID: Rehmannia32_contig00025298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025298 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74620.1| hypothetical protein M569_00139, partial [Genlise... 62 3e-09 gb|PIM97662.1| hypothetical protein CDL12_29864 [Handroanthus im... 62 6e-09 ref|XP_019430517.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 61 2e-08 ref|XP_012838417.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 60 2e-08 ref|XP_019454612.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 60 6e-08 ref|XP_018463823.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 58 8e-08 ref|XP_010521971.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 59 1e-07 ref|XP_013752431.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [... 58 1e-07 dbj|GAU31049.1| hypothetical protein TSUD_214850 [Trifolium subt... 59 1e-07 ref|XP_002271024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 59 1e-07 gb|PNX88338.1| hypothetical protein L195_g044441, partial [Trifo... 58 2e-07 ref|XP_006410079.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [... 58 2e-07 emb|CBI31085.3| unnamed protein product, partial [Vitis vinifera] 59 2e-07 ref|XP_020205661.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-l... 58 2e-07 ref|XP_017238505.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 58 3e-07 ref|XP_010906823.2| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 58 3e-07 ref|XP_019460293.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 58 3e-07 ref|XP_008811689.1| PREDICTED: protein G1-like7 [Phoenix dactyli... 58 3e-07 ref|XP_016165385.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5-l... 58 3e-07 ref|XP_015932033.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [... 58 3e-07 >gb|EPS74620.1| hypothetical protein M569_00139, partial [Genlisea aurea] Length = 171 Score = 62.4 bits (150), Expect = 3e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 347 QPPSRYESQKRRDWNTFQQYLRNHKP 424 QPPSRYESQKRRDWNTFQQYLRNHKP Sbjct: 26 QPPSRYESQKRRDWNTFQQYLRNHKP 51 >gb|PIM97662.1| hypothetical protein CDL12_29864 [Handroanthus impetiginosus] Length = 196 Score = 62.0 bits (149), Expect = 6e-09 Identities = 32/55 (58%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +2 Query: 266 MDSASG--GEXXXXXXXXXXXXXXXXXXXQPPSRYESQKRRDWNTFQQYLRNHKP 424 MDS+SG GE PPSRYESQKRRDWNTFQQYLRNHKP Sbjct: 1 MDSSSGAGGEAPMSTTTTSAPSAGGGESTPPPSRYESQKRRDWNTFQQYLRNHKP 55 >ref|XP_019430517.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5-like [Lupinus angustifolius] gb|OIW20179.1| hypothetical protein TanjilG_06567 [Lupinus angustifolius] Length = 215 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/53 (56%), Positives = 30/53 (56%) Frame = +2 Query: 266 MDSASGGEXXXXXXXXXXXXXXXXXXXQPPSRYESQKRRDWNTFQQYLRNHKP 424 MDSASG PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 1 MDSASGNPSSVAGASATTPHGEGPSPAPPPSRYESQKRRDWNTFLQYLRNHKP 53 >ref|XP_012838417.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Erythranthe guttata] gb|EYU45980.1| hypothetical protein MIMGU_mgv1a021801mg [Erythranthe guttata] Length = 201 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTFQQYLRNHKP Sbjct: 40 PPSRYESQKRRDWNTFQQYLRNHKP 64 >ref|XP_019454612.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5-like [Lupinus angustifolius] gb|OIW04385.1| hypothetical protein TanjilG_32577 [Lupinus angustifolius] Length = 225 Score = 59.7 bits (143), Expect = 6e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 347 QPPSRYESQKRRDWNTFQQYLRNHKP 424 QPPSRYESQKRRDWNTF QYLRNHKP Sbjct: 41 QPPSRYESQKRRDWNTFLQYLRNHKP 66 >ref|XP_018463823.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Raphanus sativus] Length = 155 Score = 58.2 bits (139), Expect = 8e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 347 QPPSRYESQKRRDWNTFQQYLRNHKP 424 +PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 23 RPPSRYESQKRRDWNTFLQYLRNHKP 48 >ref|XP_010521971.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5-like [Tarenaya hassleriana] Length = 204 Score = 58.5 bits (140), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 347 QPPSRYESQKRRDWNTFQQYLRNHKP 424 QPPSRYESQKRRDWNTF QYL+NHKP Sbjct: 38 QPPSRYESQKRRDWNTFLQYLKNHKP 63 >ref|XP_013752431.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Brassica napus] emb|CDY10712.1| BnaA05g12240D [Brassica napus] Length = 165 Score = 57.8 bits (138), Expect = 1e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 22 PPSRYESQKRRDWNTFLQYLRNHKP 46 >dbj|GAU31049.1| hypothetical protein TSUD_214850 [Trifolium subterraneum] Length = 217 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/53 (52%), Positives = 30/53 (56%) Frame = +2 Query: 266 MDSASGGEXXXXXXXXXXXXXXXXXXXQPPSRYESQKRRDWNTFQQYLRNHKP 424 M++ S GE PSRYESQKRRDWNTFQQYLRNHKP Sbjct: 1 MEATSAGEKSQPPAPPQPQTEPSSPPTATPSRYESQKRRDWNTFQQYLRNHKP 53 >ref|XP_002271024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Vitis vinifera] Length = 220 Score = 58.5 bits (140), Expect = 1e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 347 QPPSRYESQKRRDWNTFQQYLRNHKP 424 QPPSRYESQKRRDWNTF QYLRNH+P Sbjct: 44 QPPSRYESQKRRDWNTFGQYLRNHRP 69 >gb|PNX88338.1| hypothetical protein L195_g044441, partial [Trifolium pratense] Length = 179 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 353 PSRYESQKRRDWNTFQQYLRNHKP 424 PSRYESQKRRDWNTFQQYLRNHKP Sbjct: 29 PSRYESQKRRDWNTFQQYLRNHKP 52 >ref|XP_006410079.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Eutrema salsugineum] gb|ESQ51532.1| hypothetical protein EUTSA_v10017270mg [Eutrema salsugineum] Length = 195 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 25 PPSRYESQKRRDWNTFLQYLRNHKP 49 >emb|CBI31085.3| unnamed protein product, partial [Vitis vinifera] Length = 267 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 347 QPPSRYESQKRRDWNTFQQYLRNHKP 424 QPPSRYESQKRRDWNTF QYLRNH+P Sbjct: 87 QPPSRYESQKRRDWNTFGQYLRNHRP 112 >ref|XP_020205661.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Cajanus cajan] Length = 207 Score = 57.8 bits (138), Expect = 2e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 18 PPSRYESQKRRDWNTFLQYLRNHKP 42 >ref|XP_017238505.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Daucus carota subsp. sativus] gb|KZN03526.1| hypothetical protein DCAR_012282 [Daucus carota subsp. sativus] Length = 209 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 32 PPSRYESQKRRDWNTFLQYLRNHKP 56 >ref|XP_010906823.2| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Elaeis guineensis] Length = 213 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 33 PPSRYESQKRRDWNTFLQYLRNHKP 57 >ref|XP_019460293.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5-like [Lupinus angustifolius] gb|OIW02589.1| hypothetical protein TanjilG_24040 [Lupinus angustifolius] Length = 218 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 347 QPPSRYESQKRRDWNTFQQYLRNHKP 424 QPPSRYESQKRRDWNTF QYLR+HKP Sbjct: 35 QPPSRYESQKRRDWNTFLQYLRSHKP 60 >ref|XP_008811689.1| PREDICTED: protein G1-like7 [Phoenix dactylifera] Length = 218 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 33 PPSRYESQKRRDWNTFLQYLRNHKP 57 >ref|XP_016165385.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5-like [Arachis ipaensis] Length = 220 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 24 PPSRYESQKRRDWNTFLQYLRNHKP 48 >ref|XP_015932033.1| protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Arachis duranensis] Length = 220 Score = 57.8 bits (138), Expect = 3e-07 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +2 Query: 350 PPSRYESQKRRDWNTFQQYLRNHKP 424 PPSRYESQKRRDWNTF QYLRNHKP Sbjct: 24 PPSRYESQKRRDWNTFLQYLRNHKP 48