BLASTX nr result
ID: Rehmannia32_contig00025256
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025256 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095504.1| uncharacterized protein LOC105174942 [Sesamu... 67 1e-10 >ref|XP_011095504.1| uncharacterized protein LOC105174942 [Sesamum indicum] ref|XP_020553913.1| uncharacterized protein LOC105174942 [Sesamum indicum] Length = 258 Score = 66.6 bits (161), Expect = 1e-10 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 9/71 (12%) Frame = +2 Query: 179 MNGIWISLKGSMNCGS--TDVARLPEKM---RSSTSPD-EEFKNEVTHP---FKFRHYCM 331 MN IWISLK ++NCGS TDVARLPEKM RSSTS + + +E P KFRHY + Sbjct: 1 MNSIWISLKENINCGSKMTDVARLPEKMARRRSSTSAERNQLTDEHESPLLQLKFRHYPI 60 Query: 332 RNRFHELGVGE 364 R+RF EL +G+ Sbjct: 61 RSRFQELEIGD 71