BLASTX nr result
ID: Rehmannia32_contig00025173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00025173 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022871882.1| collagen alpha-2(IV) chain-like [Olea europa... 56 4e-07 >ref|XP_022871882.1| collagen alpha-2(IV) chain-like [Olea europaea var. sylvestris] Length = 169 Score = 56.2 bits (134), Expect = 4e-07 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = -1 Query: 243 IDQTYLEGGGE--SKLGMEGILGMEGIFGSPVGSEGIGGIENFGMPGIVGIVGNV 85 + YLEGGG+ +GMEGILGMEG +EGIGG E GMPG+ GIVG V Sbjct: 82 LPMVYLEGGGDRTGMVGMEGILGMEG-------NEGIGGNETLGMPGMAGIVGCV 129