BLASTX nr result
ID: Rehmannia32_contig00024699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00024699 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20343.1| hypothetical protein MIMGU_mgv1a021379mg [Erythra... 71 2e-12 gb|PIN06841.1| hypothetical protein CDL12_20614 [Handroanthus im... 54 5e-06 >gb|EYU20343.1| hypothetical protein MIMGU_mgv1a021379mg [Erythranthe guttata] Length = 189 Score = 71.2 bits (173), Expect = 2e-12 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -3 Query: 151 LFPKPLVVLATNPISIAQSHSNRTATMIWDHYRGTPAPKIELKKRYKRCV 2 LFPKPL VL P+S+AQSH+N+TA +IWDHY G P K E++ RY RCV Sbjct: 62 LFPKPLFVLGAGPMSMAQSHANKTAKVIWDHYHGKPFWKDEIRLRYNRCV 111 >gb|PIN06841.1| hypothetical protein CDL12_20614 [Handroanthus impetiginosus] Length = 199 Score = 54.3 bits (129), Expect = 5e-06 Identities = 41/129 (31%), Positives = 59/129 (45%), Gaps = 9/129 (6%) Frame = -3 Query: 361 SSIASFLIILAMSPPANSFKHETIVINPRITNLPETPHSCFLLYC*HYLLQPIVPPITQW 182 +S FL++L +S P NS + I+INP IT P ++ ++ I P Sbjct: 8 NSFLFFLVLLTISSPINSSDNYEIIINPIITKAPP------VVIVTDTVIHKICPRTQD- 60 Query: 181 LS*IPELSRH---------LFPKPLVVLATNPISIAQSHSNRTATMIWDHYRGTPAPKIE 29 P L R+ LFP+PL + I IAQ+H+ +TA IW Y K E Sbjct: 61 ----PNLCRYILNQFKGKPLFPEPLARI----IGIAQNHAQKTAKKIWSLYDSIKDNKSE 112 Query: 28 LKKRYKRCV 2 LK Y +C+ Sbjct: 113 LKLSYNKCL 121