BLASTX nr result
ID: Rehmannia32_contig00024250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00024250 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017615797.1| PREDICTED: protein spalten-like [Gossypium a... 62 4e-09 gb|PPS09486.1| hypothetical protein GOBAR_AA11145 [Gossypium bar... 62 4e-09 ref|XP_016711324.1| PREDICTED: pollen-specific leucine-rich repe... 62 4e-09 ref|XP_016717476.1| PREDICTED: brain acid soluble protein 1-like... 61 8e-09 ref|XP_012454061.1| PREDICTED: histone H1-II-like isoform X1 [Go... 61 1e-08 ref|XP_016711326.1| PREDICTED: uncharacterized protein LOC107925... 60 1e-08 gb|PPS09487.1| hypothetical protein GOBAR_AA11146 [Gossypium bar... 60 2e-08 ref|XP_016554156.1| PREDICTED: pollen-specific leucine-rich repe... 60 3e-08 ref|XP_016554155.1| PREDICTED: pollen-specific leucine-rich repe... 60 3e-08 ref|XP_012848568.1| PREDICTED: pollen-specific leucine-rich repe... 59 5e-08 ref|XP_021828076.1| chitin-binding lectin 1-like isoform X1 [Pru... 59 5e-08 ref|XP_016683475.1| PREDICTED: 104 kDa microneme/rhoptry antigen... 59 5e-08 emb|CDO99450.1| unnamed protein product [Coffea canephora] 57 6e-08 ref|XP_011095916.1| pollen-specific leucine-rich repeat extensin... 59 6e-08 ref|XP_017615798.1| PREDICTED: uncharacterized protein LOC108460... 59 6e-08 ref|XP_017612636.1| PREDICTED: 104 kDa microneme/rhoptry antigen... 59 7e-08 ref|XP_022868066.1| protein PYRICULARIA ORYZAE RESISTANCE 21-lik... 57 7e-08 ref|XP_012450836.1| PREDICTED: predicted GPI-anchored protein 58... 59 8e-08 gb|PPS05002.1| hypothetical protein GOBAR_AA15653 [Gossypium bar... 59 8e-08 ref|XP_016753799.1| PREDICTED: sporozoite surface protein 2-like... 59 8e-08 >ref|XP_017615797.1| PREDICTED: protein spalten-like [Gossypium arboreum] Length = 248 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQCS CYKK KK LCKFP+ Sbjct: 1 MAEKVTIMVLKVDLQCSKCYKKVKKVLCKFPQ 32 >gb|PPS09486.1| hypothetical protein GOBAR_AA11145 [Gossypium barbadense] Length = 253 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQCS CYKK KK LCKFP+ Sbjct: 1 MAEKVTIMVLKVDLQCSKCYKKVKKVLCKFPQ 32 >ref|XP_016711324.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 2 [Gossypium hirsutum] Length = 256 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQCS CYKK KK LCKFP+ Sbjct: 1 MAEKVTIMVLKVDLQCSKCYKKVKKVLCKFPQ 32 >ref|XP_016717476.1| PREDICTED: brain acid soluble protein 1-like [Gossypium hirsutum] Length = 233 Score = 61.2 bits (147), Expect = 8e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQCS CYKK KK LCK+P+ Sbjct: 1 MAEKVTIMVLKVDLQCSKCYKKVKKVLCKYPQ 32 >ref|XP_012454061.1| PREDICTED: histone H1-II-like isoform X1 [Gossypium raimondii] gb|KJB69156.1| hypothetical protein B456_011G008600 [Gossypium raimondii] Length = 252 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQCS CYKK KK LCK+P+ Sbjct: 1 MAEKVTIMVLKVDLQCSKCYKKVKKVLCKYPQ 32 >ref|XP_016711326.1| PREDICTED: uncharacterized protein LOC107925210 isoform X1 [Gossypium hirsutum] Length = 208 Score = 60.5 bits (145), Expect = 1e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTIMVLKVDLQCRKCYKKVKKVLCKFPQ 32 >gb|PPS09487.1| hypothetical protein GOBAR_AA11146 [Gossypium barbadense] Length = 282 Score = 60.5 bits (145), Expect = 2e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTIMVLKVDLQCRKCYKKVKKVLCKFPQ 32 >ref|XP_016554156.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 isoform X2 [Capsicum annuum] Length = 304 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 45 EKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 EKVTIMVLKVDLQCSSCYKK KK LCKFP+ Sbjct: 7 EKVTIMVLKVDLQCSSCYKKVKKVLCKFPQ 36 >ref|XP_016554155.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 isoform X1 [Capsicum annuum] Length = 316 Score = 60.5 bits (145), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 45 EKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 EKVTIMVLKVDLQCSSCYKK KK LCKFP+ Sbjct: 7 EKVTIMVLKVDLQCSSCYKKVKKVLCKFPQ 36 >ref|XP_012848568.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Erythranthe guttata] gb|EYU27661.1| hypothetical protein MIMGU_mgv1a012649mg [Erythranthe guttata] Length = 244 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVT+MVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTVMVLKVDLQCPCCYKKVKKILCKFPQ 32 >ref|XP_021828076.1| chitin-binding lectin 1-like isoform X1 [Prunus avium] Length = 189 Score = 58.5 bits (140), Expect = 5e-08 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +3 Query: 45 EKVTIMVLKVDLQCSSCYKKTKKTLCKFPRE 137 EKVT MVLKVDLQC CYKK KK LCKFPRE Sbjct: 5 EKVTTMVLKVDLQCHKCYKKVKKVLCKFPRE 35 >ref|XP_016683475.1| PREDICTED: 104 kDa microneme/rhoptry antigen-like [Gossypium hirsutum] Length = 251 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTIMVLKVDLQCWRCYKKVKKVLCKFPQ 32 >emb|CDO99450.1| unnamed protein product [Coffea canephora] Length = 105 Score = 56.6 bits (135), Expect = 6e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVT+M L VDLQC SCYKK KK LCKFP+ Sbjct: 1 MAEKVTVMRLNVDLQCPSCYKKVKKILCKFPQ 32 >ref|XP_011095916.1| pollen-specific leucine-rich repeat extensin-like protein 1 [Sesamum indicum] ref|XP_020554108.1| pollen-specific leucine-rich repeat extensin-like protein 1 [Sesamum indicum] Length = 275 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVT+MVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTVMVLKVDLQCPCCYKKVKKILCKFPQ 32 >ref|XP_017615798.1| PREDICTED: uncharacterized protein LOC108460708 isoform X1 [Gossypium arboreum] Length = 207 Score = 58.5 bits (140), Expect = 6e-08 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVTIMVLKVDLQC CYKK KK LC FP+ Sbjct: 1 MAEKVTIMVLKVDLQCRKCYKKVKKVLCNFPQ 32 >ref|XP_017612636.1| PREDICTED: 104 kDa microneme/rhoptry antigen-like [Gossypium arboreum] gb|KHG01648.1| hypothetical protein F383_21782 [Gossypium arboreum] Length = 254 Score = 58.9 bits (141), Expect = 7e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVT+MVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTVMVLKVDLQCWRCYKKVKKVLCKFPQ 32 >ref|XP_022868066.1| protein PYRICULARIA ORYZAE RESISTANCE 21-like [Olea europaea var. sylvestris] Length = 115 Score = 56.6 bits (135), Expect = 7e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFP 131 MAE VT MVLKVDLQC+SCYKK KK LCKFP Sbjct: 1 MAETVTEMVLKVDLQCTSCYKKIKKILCKFP 31 >ref|XP_012450836.1| PREDICTED: predicted GPI-anchored protein 58 [Gossypium raimondii] gb|KJB67415.1| hypothetical protein B456_010G190100 [Gossypium raimondii] Length = 263 Score = 58.9 bits (141), Expect = 8e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVT+MVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTVMVLKVDLQCWRCYKKVKKVLCKFPQ 32 >gb|PPS05002.1| hypothetical protein GOBAR_AA15653 [Gossypium barbadense] Length = 266 Score = 58.9 bits (141), Expect = 8e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVT+MVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTVMVLKVDLQCWRCYKKVKKVLCKFPQ 32 >ref|XP_016753799.1| PREDICTED: sporozoite surface protein 2-like [Gossypium hirsutum] Length = 266 Score = 58.9 bits (141), Expect = 8e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 39 MAEKVTIMVLKVDLQCSSCYKKTKKTLCKFPR 134 MAEKVT+MVLKVDLQC CYKK KK LCKFP+ Sbjct: 1 MAEKVTVMVLKVDLQCWRCYKKVKKVLCKFPQ 32