BLASTX nr result
ID: Rehmannia32_contig00023914
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00023914 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01341.1| ATP binding protein [Handroanthus impetiginosus] 99 2e-22 ref|XP_012836880.1| PREDICTED: thioredoxin domain-containing pro... 94 1e-20 gb|PIA33040.1| hypothetical protein AQUCO_04200055v1 [Aquilegia ... 86 1e-17 emb|CAN66100.1| hypothetical protein VITISV_013928 [Vitis vinifera] 86 2e-17 ref|XP_002271696.1| PREDICTED: thioredoxin domain-containing pro... 86 3e-17 ref|XP_011088179.1| thioredoxin domain-containing protein 9 homo... 83 2e-16 ref|XP_022854514.1| thioredoxin domain-containing protein 9 homo... 82 4e-16 ref|XP_022145711.1| thioredoxin domain-containing protein 9 homo... 80 3e-15 ref|XP_017224075.1| PREDICTED: thioredoxin domain-containing pro... 80 4e-15 ref|XP_022896859.1| thioredoxin domain-containing protein 9 homo... 79 5e-15 ref|XP_021846157.1| thioredoxin domain-containing protein 9 homo... 79 1e-14 ref|XP_021850295.1| thioredoxin domain-containing protein 9 homo... 79 1e-14 ref|XP_020103449.1| thioredoxin domain-containing protein 9 homo... 79 1e-14 ref|XP_019170200.1| PREDICTED: thioredoxin domain-containing pro... 79 1e-14 ref|XP_011030376.1| PREDICTED: thioredoxin domain-containing pro... 79 1e-14 gb|KNA13042.1| hypothetical protein SOVF_120430 isoform B [Spina... 79 1e-14 ref|XP_022001483.1| thioredoxin domain-containing protein 9 homo... 78 1e-14 ref|XP_021753440.1| thioredoxin domain-containing protein 9 homo... 78 2e-14 gb|OAY82395.1| Thioredoxin domain-containing protein, partial [A... 79 2e-14 ref|XP_023768665.1| thioredoxin domain-containing protein 9 homo... 78 2e-14 >gb|PIN01341.1| ATP binding protein [Handroanthus impetiginosus] Length = 212 Score = 98.6 bits (244), Expect = 2e-22 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG D+FST+ELEERLAKAQVI YEGESSLNPSKSKAP+R+VRQGS+SYSSDS+ Sbjct: 157 DELGGTDEFSTEELEERLAKAQVIFYEGESSLNPSKSKAPTRSVRQGSSSYSSDSE 212 >ref|XP_012836880.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Erythranthe guttata] gb|EYU37604.1| hypothetical protein MIMGU_mgv1a013704mg [Erythranthe guttata] Length = 212 Score = 94.4 bits (233), Expect = 1e-20 Identities = 42/56 (75%), Positives = 55/56 (98%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG+DDFST+ELEER+AKAQVI++EGESS+NP+KSKAP+RNVR+ +T+Y+SDS+ Sbjct: 157 DELGGKDDFSTEELEERIAKAQVIIHEGESSMNPTKSKAPTRNVRKSATTYASDSE 212 >gb|PIA33040.1| hypothetical protein AQUCO_04200055v1 [Aquilegia coerulea] Length = 211 Score = 86.3 bits (212), Expect = 1e-17 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 D+LGG DDFSTDELEERLAK+ VI++EGESSLNPSK+KA SR+VRQ + + SSDSD Sbjct: 156 DQLGGTDDFSTDELEERLAKSNVIIFEGESSLNPSKAKAASRSVRQSTHADSSDSD 211 >emb|CAN66100.1| hypothetical protein VITISV_013928 [Vitis vinifera] Length = 207 Score = 85.5 bits (210), Expect = 2e-17 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG D+FST+ELEERLAKAQVI++EGESSL+ SKS + R+VRQ S SYSSDSD Sbjct: 152 DELGGTDEFSTEELEERLAKAQVIIFEGESSLHASKSSSQPRSVRQSSNSYSSDSD 207 >ref|XP_002271696.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Vitis vinifera] emb|CBI22498.3| unnamed protein product, partial [Vitis vinifera] Length = 212 Score = 85.5 bits (210), Expect = 3e-17 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG D+FST+ELEERLAKAQVI++EGESSL+ SKS + R+VRQ S SYSSDSD Sbjct: 157 DELGGTDEFSTEELEERLAKAQVIIFEGESSLHASKSSSQPRSVRQSSNSYSSDSD 212 >ref|XP_011088179.1| thioredoxin domain-containing protein 9 homolog [Sesamum indicum] Length = 210 Score = 83.2 bits (204), Expect = 2e-16 Identities = 43/56 (76%), Positives = 50/56 (89%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG D+FST+ELEERLAKAQVI+YEGESS SKSKAP+R+VRQ +SYSSDS+ Sbjct: 157 DELGGTDEFSTEELEERLAKAQVIIYEGESSHRASKSKAPTRSVRQ--SSYSSDSE 210 >ref|XP_022854514.1| thioredoxin domain-containing protein 9 homolog [Olea europaea var. sylvestris] Length = 210 Score = 82.4 bits (202), Expect = 4e-16 Identities = 42/56 (75%), Positives = 51/56 (91%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG+DDFST+ELEERLAK+QVIVYEGESSL+ SKSK +++VRQ +SYSSDS+ Sbjct: 157 DELGGKDDFSTEELEERLAKSQVIVYEGESSLHASKSKGKTKSVRQ--SSYSSDSE 210 >ref|XP_022145711.1| thioredoxin domain-containing protein 9 homolog [Momordica charantia] ref|XP_022145719.1| thioredoxin domain-containing protein 9 homolog [Momordica charantia] ref|XP_022145726.1| thioredoxin domain-containing protein 9 homolog [Momordica charantia] Length = 212 Score = 80.1 bits (196), Expect = 3e-15 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG D+FST+ELEERLAK QVI YEGESS+N SKS A +R+VRQ + S SSDS+ Sbjct: 157 DELGGTDEFSTEELEERLAKCQVIFYEGESSINASKSSAQTRSVRQSTRSDSSDSE 212 >ref|XP_017224075.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Daucus carota subsp. sativus] gb|KZM81486.1| hypothetical protein DCAR_029099 [Daucus carota subsp. sativus] Length = 212 Score = 79.7 bits (195), Expect = 4e-15 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG DDF T+ELE+RLAK QVI+ EGESSL PSKS A +R+VRQG+ SSDS+ Sbjct: 157 DELGGTDDFGTEELEDRLAKVQVIILEGESSLRPSKSSAKTRSVRQGTNPDSSDSE 212 >ref|XP_022896859.1| thioredoxin domain-containing protein 9 homolog [Olea europaea var. sylvestris] Length = 210 Score = 79.3 bits (194), Expect = 5e-15 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG D+FST+ELEERLAK+QVIVYEGESSLN SKSK +++VRQ + YSSDS+ Sbjct: 157 DELGGTDEFSTEELEERLAKSQVIVYEGESSLNASKSKGKTKSVRQ--SLYSSDSE 210 >ref|XP_021846157.1| thioredoxin domain-containing protein 9 homolog [Spinacia oleracea] gb|KNA23678.1| hypothetical protein SOVF_022690 [Spinacia oleracea] Length = 210 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGGRDDFST+ELEERLAK Q I+++GESS+ PS+++ +R+VRQ T SSDSD Sbjct: 155 DELGGRDDFSTEELEERLAKYQAIIFDGESSVKPSRTQGHTRSVRQSETHDSSDSD 210 >ref|XP_021850295.1| thioredoxin domain-containing protein 9 homolog isoform X1 [Spinacia oleracea] gb|KNA13041.1| hypothetical protein SOVF_120430 isoform A [Spinacia oleracea] Length = 210 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 D+LGGRDDFST+ELEERLAK Q I+++GESS+ PS+S+ +R+VRQ T SSDSD Sbjct: 155 DDLGGRDDFSTEELEERLAKHQAIIFDGESSVKPSRSQGHTRSVRQSETHDSSDSD 210 >ref|XP_020103449.1| thioredoxin domain-containing protein 9 homolog [Ananas comosus] Length = 211 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 +ELGG D+FST+ELEERL KAQVI +EGE+S NP KS R+VRQ TS+SSDSD Sbjct: 156 NELGGTDEFSTEELEERLGKAQVIFFEGEASTNPLKSSTTKRSVRQSETSHSSDSD 211 >ref|XP_019170200.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Ipomoea nil] Length = 211 Score = 78.6 bits (192), Expect = 1e-14 Identities = 39/56 (69%), Positives = 48/56 (85%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG+DDFST+ELEERLAKA+VI +EGESS+ SK K+ SR+VRQ S + SSDS+ Sbjct: 156 DELGGKDDFSTEELEERLAKAEVIHFEGESSMRASKLKSQSRSVRQSSNADSSDSE 211 >ref|XP_011030376.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Populus euphratica] Length = 212 Score = 78.6 bits (192), Expect = 1e-14 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG D+F+T++LEERLAKAQVI +EGESSLN SKS A +R+VRQ + SSDSD Sbjct: 157 DELGGTDEFNTEDLEERLAKAQVIFFEGESSLNSSKSSAQTRSVRQSESHDSSDSD 212 >gb|KNA13042.1| hypothetical protein SOVF_120430 isoform B [Spinacia oleracea] Length = 213 Score = 78.6 bits (192), Expect = 1e-14 Identities = 37/56 (66%), Positives = 47/56 (83%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 D+LGGRDDFST+ELEERLAK Q I+++GESS+ PS+S+ +R+VRQ T SSDSD Sbjct: 158 DDLGGRDDFSTEELEERLAKHQAIIFDGESSVKPSRSQGHTRSVRQSETHDSSDSD 213 >ref|XP_022001483.1| thioredoxin domain-containing protein 9 homolog [Helianthus annuus] gb|OTG01966.1| putative thioredoxin domain-containing protein 9 [Helianthus annuus] Length = 209 Score = 78.2 bits (191), Expect = 1e-14 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG DDFST+ELEERL+KAQVI +EGESS+ PSKS+ +RNVR GS S SDS+ Sbjct: 156 DELGGTDDFSTEELEERLSKAQVIFFEGESSMKPSKSQ--TRNVRHGSNSNGSDSE 209 >ref|XP_021753440.1| thioredoxin domain-containing protein 9 homolog [Chenopodium quinoa] Length = 212 Score = 78.2 bits (191), Expect = 2e-14 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG+DDFSTDELEERLAK Q+I++EGESS+ S+S +R+VRQ T SSDSD Sbjct: 157 DELGGKDDFSTDELEERLAKYQIIIFEGESSVKSSRSLGHTRSVRQSETHDSSDSD 212 >gb|OAY82395.1| Thioredoxin domain-containing protein, partial [Ananas comosus] Length = 245 Score = 78.6 bits (192), Expect = 2e-14 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 +ELGG D+FST+ELEERL KAQVI +EGE+S NP KS R+VRQ TS+SSDSD Sbjct: 190 NELGGTDEFSTEELEERLGKAQVIFFEGEASTNPLKSSTTKRSVRQSETSHSSDSD 245 >ref|XP_023768665.1| thioredoxin domain-containing protein 9 homolog [Lactuca sativa] gb|PLY81722.1| hypothetical protein LSAT_3X25161 [Lactuca sativa] Length = 210 Score = 77.8 bits (190), Expect = 2e-14 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = -3 Query: 525 DELGGRDDFSTDELEERLAKAQVIVYEGESSLNPSKSKAPSRNVRQGSTSYSSDSD 358 DELGG DDFST+ELEERL K +VI +EGESSL PSK K +RNVR GS S+ SDSD Sbjct: 156 DELGGSDDFSTEELEERLGKGEVIFFEGESSLKPSK-KPQTRNVRHGSNSHLSDSD 210