BLASTX nr result
ID: Rehmannia32_contig00023795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00023795 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN09374.1| hypothetical protein CDL12_18052 [Handroanthus im... 77 6e-14 >gb|PIN09374.1| hypothetical protein CDL12_18052 [Handroanthus impetiginosus] gb|PIN10618.1| hypothetical protein CDL12_16796 [Handroanthus impetiginosus] Length = 282 Score = 77.0 bits (188), Expect = 6e-14 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +2 Query: 314 MSTSATDGANGGAGPLLDPSQRHHHQLQPGPTNNSNNSALVVKKPPAK 457 MSTSAT+GANGG GP++DPSQR HHQLQ TNN+NN+AL VKKPPAK Sbjct: 1 MSTSATEGANGGGGPIVDPSQR-HHQLQSPSTNNTNNAALPVKKPPAK 47