BLASTX nr result
ID: Rehmannia32_contig00023787
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00023787 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN27155.1| hypothetical protein CDL12_00071 [Handroanthus im... 185 4e-54 ref|XP_020552697.1| pentatricopeptide repeat-containing protein ... 176 3e-51 ref|XP_012830735.1| PREDICTED: pentatricopeptide repeat-containi... 175 2e-50 ref|XP_011091754.2| pentatricopeptide repeat-containing protein ... 176 2e-50 ref|XP_020553770.1| pentatricopeptide repeat-containing protein ... 169 1e-48 ref|XP_020553766.1| pentatricopeptide repeat-containing protein ... 169 5e-48 ref|XP_011093701.1| pentatricopeptide repeat-containing protein ... 169 5e-48 gb|KZV30940.1| pentatricopeptide repeat-containing protein-like ... 166 1e-46 ref|XP_016463224.1| PREDICTED: pentatricopeptide repeat-containi... 136 2e-35 ref|XP_016463223.1| PREDICTED: pentatricopeptide repeat-containi... 136 3e-35 ref|XP_009621271.1| PREDICTED: pentatricopeptide repeat-containi... 135 3e-35 ref|XP_011025474.1| PREDICTED: pentatricopeptide repeat-containi... 135 4e-35 ref|XP_016481204.1| PREDICTED: pentatricopeptide repeat-containi... 135 4e-35 ref|XP_016481202.1| PREDICTED: pentatricopeptide repeat-containi... 135 6e-35 ref|XP_009761953.1| PREDICTED: pentatricopeptide repeat-containi... 135 6e-35 ref|XP_009761950.1| PREDICTED: pentatricopeptide repeat-containi... 135 8e-35 gb|PNT19833.1| hypothetical protein POPTR_009G058300v3 [Populus ... 134 9e-35 gb|PNT19834.1| hypothetical protein POPTR_009G058400v3 [Populus ... 134 9e-35 ref|XP_002313317.2| hypothetical protein POPTR_0009s06340g [Popu... 134 9e-35 gb|PNT19835.1| hypothetical protein POPTR_009G058400v3 [Populus ... 134 9e-35 >gb|PIN27155.1| hypothetical protein CDL12_00071 [Handroanthus impetiginosus] Length = 464 Score = 185 bits (469), Expect = 4e-54 Identities = 96/119 (80%), Positives = 102/119 (85%) Frame = -2 Query: 358 MELRLLNPANLRSSSIVKSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIE 179 MEL L NP N+R SS+ SKKNPDSD QPQ Q RKFSKKDLSRILRTE+AIKAIE Sbjct: 1 MELHLRNPPNIRRSSVTVM-SKKNPDSDSTSQPQPVQIRKFSKKDLSRILRTEAAIKAIE 59 Query: 178 RKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 +KANSSKYNNL PKAVLEALNDAIKQNRWESALKIFDLLR+Q WYEPR QTYAK+LVML Sbjct: 60 KKANSSKYNNLWPKAVLEALNDAIKQNRWESALKIFDLLRKQHWYEPRTQTYAKLLVML 118 >ref|XP_020552697.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Sesamum indicum] Length = 427 Score = 176 bits (447), Expect = 3e-51 Identities = 95/121 (78%), Positives = 102/121 (84%), Gaps = 1/121 (0%) Frame = -2 Query: 361 AMELRLLNPANLRSSSI-VKSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKA 185 AMEL L NPANLR SS V+S SKK PD D + Q QFRK SKKDLSRILRTE+AIKA Sbjct: 32 AMELLLRNPANLRRSSFKVESSSKKIPDCDSNSRSQGLQFRKLSKKDLSRILRTEAAIKA 91 Query: 184 IERKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVM 5 IE+KANSSKY NL PKAVLEAL+DAIKQNRWESALKIFDLLR+Q WYEPR QTYAK+LVM Sbjct: 92 IEKKANSSKYKNLWPKAVLEALSDAIKQNRWESALKIFDLLRQQHWYEPRSQTYAKLLVM 151 Query: 4 L 2 L Sbjct: 152 L 152 >ref|XP_012830735.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170 [Erythranthe guttata] Length = 459 Score = 175 bits (444), Expect = 2e-50 Identities = 92/120 (76%), Positives = 101/120 (84%), Gaps = 1/120 (0%) Frame = -2 Query: 358 MELRLLNPANLRSSSI-VKSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKAI 182 MELRL NPANLR + V+S S K PDSD +P++ QFRK SKKDLSRILRTESAIKA+ Sbjct: 1 MELRLYNPANLRRFCLTVQSRSNKTPDSDRNCEPEALQFRKLSKKDLSRILRTESAIKAV 60 Query: 181 ERKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 ERK+ SSKYNNL PKAVLEALNDAIK NRWESALKIFDLLR+Q WYEPR QTY K+LVML Sbjct: 61 ERKSKSSKYNNLWPKAVLEALNDAIKLNRWESALKIFDLLRKQHWYEPRGQTYTKLLVML 120 >ref|XP_011091754.2| pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Sesamum indicum] ref|XP_011091755.2| pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Sesamum indicum] ref|XP_011091756.2| pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Sesamum indicum] ref|XP_011091757.2| pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Sesamum indicum] Length = 514 Score = 176 bits (447), Expect = 2e-50 Identities = 95/121 (78%), Positives = 102/121 (84%), Gaps = 1/121 (0%) Frame = -2 Query: 361 AMELRLLNPANLRSSSI-VKSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKA 185 AMEL L NPANLR SS V+S SKK PD D + Q QFRK SKKDLSRILRTE+AIKA Sbjct: 32 AMELLLRNPANLRRSSFKVESSSKKIPDCDSNSRSQGLQFRKLSKKDLSRILRTEAAIKA 91 Query: 184 IERKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVM 5 IE+KANSSKY NL PKAVLEAL+DAIKQNRWESALKIFDLLR+Q WYEPR QTYAK+LVM Sbjct: 92 IEKKANSSKYKNLWPKAVLEALSDAIKQNRWESALKIFDLLRQQHWYEPRSQTYAKLLVM 151 Query: 4 L 2 L Sbjct: 152 L 152 >ref|XP_020553770.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X3 [Sesamum indicum] Length = 395 Score = 169 bits (428), Expect = 1e-48 Identities = 91/120 (75%), Positives = 100/120 (83%), Gaps = 1/120 (0%) Frame = -2 Query: 358 MELRLLNPANLRSSSI-VKSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKAI 182 MEL NPANLR SS V+S SKK+PD D + Q QFRK SKKDLSRILRTE+AIKAI Sbjct: 1 MELLRSNPANLRVSSFKVESSSKKSPDCDSNSRSQGLQFRKLSKKDLSRILRTEAAIKAI 60 Query: 181 ERKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 E+KANSSKY NL PKAVLEAL+DAIKQNRWESALKIF+LL +Q WYEPR QTYAK+LVML Sbjct: 61 EKKANSSKYKNLWPKAVLEALSDAIKQNRWESALKIFELLCQQHWYEPRSQTYAKLLVML 120 >ref|XP_020553766.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Sesamum indicum] ref|XP_020553767.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Sesamum indicum] ref|XP_020553768.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Sesamum indicum] ref|XP_020553769.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Sesamum indicum] Length = 463 Score = 169 bits (428), Expect = 5e-48 Identities = 91/120 (75%), Positives = 100/120 (83%), Gaps = 1/120 (0%) Frame = -2 Query: 358 MELRLLNPANLRSSSI-VKSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKAI 182 MEL NPANLR SS V+S SKK+PD D + Q QFRK SKKDLSRILRTE+AIKAI Sbjct: 1 MELLRSNPANLRVSSFKVESSSKKSPDCDSNSRSQGLQFRKLSKKDLSRILRTEAAIKAI 60 Query: 181 ERKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 E+KANSSKY NL PKAVLEAL+DAIKQNRWESALKIF+LL +Q WYEPR QTYAK+LVML Sbjct: 61 EKKANSSKYKNLWPKAVLEALSDAIKQNRWESALKIFELLCQQHWYEPRSQTYAKLLVML 120 >ref|XP_011093701.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Sesamum indicum] Length = 463 Score = 169 bits (428), Expect = 5e-48 Identities = 91/120 (75%), Positives = 100/120 (83%), Gaps = 1/120 (0%) Frame = -2 Query: 358 MELRLLNPANLRSSSI-VKSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKAI 182 MEL NPANLR SS V+S SKK+PD D + Q QFRK SKKDLSRILRTE+AIKAI Sbjct: 1 MELLRSNPANLRVSSFKVESSSKKSPDCDSNSRSQGLQFRKLSKKDLSRILRTEAAIKAI 60 Query: 181 ERKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 E+KANSSKY NL PKAVLEAL+DAIKQNRWESALKIF+LL +Q WYEPR QTYAK+LVML Sbjct: 61 EKKANSSKYKNLWPKAVLEALSDAIKQNRWESALKIFELLCQQHWYEPRSQTYAKLLVML 120 >gb|KZV30940.1| pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 467 Score = 166 bits (419), Expect = 1e-46 Identities = 84/120 (70%), Positives = 98/120 (81%), Gaps = 1/120 (0%) Frame = -2 Query: 358 MELRLLNPANLRSSSIV-KSYSKKNPDSDIYPQPQSPQFRKFSKKDLSRILRTESAIKAI 182 MEL LNPA +R S KS S++NPD D + + Q R FSKKDLSRILRTE+AIKAI Sbjct: 1 MELHKLNPAAIRVSCFAGKSSSRRNPDHDSSNESRGLQLRNFSKKDLSRILRTEAAIKAI 60 Query: 181 ERKANSSKYNNLLPKAVLEALNDAIKQNRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 ++KANS K++NL PKA+LEALNDAI++NRWESALKIFDLLRRQ WYEPRCQTY K+LVML Sbjct: 61 DKKANSKKHSNLWPKAILEALNDAIRRNRWESALKIFDLLRRQNWYEPRCQTYTKLLVML 120 >ref|XP_016463224.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Nicotiana tabacum] Length = 481 Score = 136 bits (342), Expect = 2e-35 Identities = 67/93 (72%), Positives = 77/93 (82%) Frame = -2 Query: 280 SDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQ 101 S + P+ S +K SKKDLSR+LRTE+AI IERKANS KY NL PKAVLEAL+D+IKQ Sbjct: 44 SSLIPESTSGGLQKSSKKDLSRLLRTEAAIIGIERKANSQKYTNLWPKAVLEALDDSIKQ 103 Query: 100 NRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 NRW+SALKIF LLR+Q WYEPRC TYAK+LVML Sbjct: 104 NRWDSALKIFGLLRKQHWYEPRCHTYAKLLVML 136 >ref|XP_016463223.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Nicotiana tabacum] Length = 503 Score = 136 bits (342), Expect = 3e-35 Identities = 67/93 (72%), Positives = 77/93 (82%) Frame = -2 Query: 280 SDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQ 101 S + P+ S +K SKKDLSR+LRTE+AI IERKANS KY NL PKAVLEAL+D+IKQ Sbjct: 44 SSLIPESTSGGLQKSSKKDLSRLLRTEAAIIGIERKANSQKYTNLWPKAVLEALDDSIKQ 103 Query: 100 NRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 NRW+SALKIF LLR+Q WYEPRC TYAK+LVML Sbjct: 104 NRWDSALKIFGLLRKQHWYEPRCHTYAKLLVML 136 >ref|XP_009621271.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170 [Nicotiana tomentosiformis] Length = 481 Score = 135 bits (341), Expect = 3e-35 Identities = 67/93 (72%), Positives = 77/93 (82%) Frame = -2 Query: 280 SDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQ 101 S + P+ S +K SKKDLSR+LRTE+AI IERKANS KY NL PKAVLEAL+D+IKQ Sbjct: 44 SSLIPESTSGGVQKSSKKDLSRLLRTEAAIIGIERKANSQKYTNLWPKAVLEALDDSIKQ 103 Query: 100 NRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 NRW+SALKIF LLR+Q WYEPRC TYAK+LVML Sbjct: 104 NRWDSALKIFGLLRKQHWYEPRCHTYAKLLVML 136 >ref|XP_011025474.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Populus euphratica] Length = 472 Score = 135 bits (340), Expect = 4e-35 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = -2 Query: 268 PQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQNRWE 89 P P S ++ SKK+LSRILRTE+AIKAIE+KANS KYNNL PKAVLEAL+DAIK+N+WE Sbjct: 37 PDPTSTGLQRHSKKELSRILRTEAAIKAIEQKANSKKYNNLWPKAVLEALDDAIKENQWE 96 Query: 88 SALKIFDLLRRQQWYEPRCQTYAKMLVML 2 SALKIF+LLR+Q WYEPR +TY K+L+ML Sbjct: 97 SALKIFELLRKQHWYEPRTKTYTKLLMML 125 >ref|XP_016481204.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Nicotiana tabacum] Length = 481 Score = 135 bits (340), Expect = 4e-35 Identities = 66/93 (70%), Positives = 78/93 (83%) Frame = -2 Query: 280 SDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQ 101 S + P+ S +K SKKDLSR+LRTE+AI+ IERKA+S KY NL PKAVLEAL+D+IKQ Sbjct: 44 SSLNPENTSGGLQKSSKKDLSRLLRTEAAIRGIERKADSEKYTNLWPKAVLEALDDSIKQ 103 Query: 100 NRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 NRW+SALKIF LLR+Q WYEPRC TYAK+LVML Sbjct: 104 NRWDSALKIFGLLRKQHWYEPRCHTYAKLLVML 136 >ref|XP_016481202.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Nicotiana tabacum] ref|XP_016481203.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like isoform X1 [Nicotiana tabacum] Length = 503 Score = 135 bits (340), Expect = 6e-35 Identities = 66/93 (70%), Positives = 78/93 (83%) Frame = -2 Query: 280 SDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQ 101 S + P+ S +K SKKDLSR+LRTE+AI+ IERKA+S KY NL PKAVLEAL+D+IKQ Sbjct: 44 SSLNPENTSGGLQKSSKKDLSRLLRTEAAIRGIERKADSEKYTNLWPKAVLEALDDSIKQ 103 Query: 100 NRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 NRW+SALKIF LLR+Q WYEPRC TYAK+LVML Sbjct: 104 NRWDSALKIFGLLRKQHWYEPRCHTYAKLLVML 136 >ref|XP_009761953.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170 isoform X2 [Nicotiana sylvestris] Length = 481 Score = 135 bits (339), Expect = 6e-35 Identities = 65/93 (69%), Positives = 78/93 (83%) Frame = -2 Query: 280 SDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQ 101 S + P+ S +K SKKDLSR+LRTE+AI+ IERKA+S KY NL PKAVLEAL+D+IKQ Sbjct: 44 SSLNPENTSGGLQKSSKKDLSRLLRTEAAIRGIERKADSEKYTNLWPKAVLEALDDSIKQ 103 Query: 100 NRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 NRW+SALK+F LLR+Q WYEPRC TYAK+LVML Sbjct: 104 NRWDSALKVFGLLRKQHWYEPRCHTYAKLLVML 136 >ref|XP_009761950.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170 isoform X1 [Nicotiana sylvestris] ref|XP_009761951.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170 isoform X1 [Nicotiana sylvestris] ref|XP_009761952.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170 isoform X1 [Nicotiana sylvestris] Length = 503 Score = 135 bits (339), Expect = 8e-35 Identities = 65/93 (69%), Positives = 78/93 (83%) Frame = -2 Query: 280 SDIYPQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQ 101 S + P+ S +K SKKDLSR+LRTE+AI+ IERKA+S KY NL PKAVLEAL+D+IKQ Sbjct: 44 SSLNPENTSGGLQKSSKKDLSRLLRTEAAIRGIERKADSEKYTNLWPKAVLEALDDSIKQ 103 Query: 100 NRWESALKIFDLLRRQQWYEPRCQTYAKMLVML 2 NRW+SALK+F LLR+Q WYEPRC TYAK+LVML Sbjct: 104 NRWDSALKVFGLLRKQHWYEPRCHTYAKLLVML 136 >gb|PNT19833.1| hypothetical protein POPTR_009G058300v3 [Populus trichocarpa] Length = 482 Score = 134 bits (338), Expect = 9e-35 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = -2 Query: 268 PQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQNRWE 89 P P S ++ SKK+LSRILRTE+AIKAIE+KANS KYNNL PKAVLEAL+DAIK+N+WE Sbjct: 47 PDPTSTGLQRQSKKELSRILRTEAAIKAIEQKANSKKYNNLWPKAVLEALDDAIKENQWE 106 Query: 88 SALKIFDLLRRQQWYEPRCQTYAKMLVML 2 SALKIF+LLR+Q WYEPR +TY K+L+ML Sbjct: 107 SALKIFELLRKQHWYEPRTKTYTKLLMML 135 >gb|PNT19834.1| hypothetical protein POPTR_009G058400v3 [Populus trichocarpa] Length = 482 Score = 134 bits (338), Expect = 9e-35 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = -2 Query: 268 PQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQNRWE 89 P P S ++ SKK+LSRILRTE+AIKAIE+KANS KYNNL PKAVLEAL+DAIK+N+WE Sbjct: 47 PDPTSTGLQRQSKKELSRILRTEAAIKAIEQKANSKKYNNLWPKAVLEALDDAIKENQWE 106 Query: 88 SALKIFDLLRRQQWYEPRCQTYAKMLVML 2 SALKIF+LLR+Q WYEPR +TY K+L+ML Sbjct: 107 SALKIFELLRKQHWYEPRTKTYTKLLMML 135 >ref|XP_002313317.2| hypothetical protein POPTR_0009s06340g [Populus trichocarpa] Length = 483 Score = 134 bits (338), Expect = 9e-35 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = -2 Query: 268 PQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQNRWE 89 P P S ++ SKK+LSRILRTE+AIKAIE+KANS KYNNL PKAVLEAL+DAIK+N+WE Sbjct: 47 PDPTSTGLQRQSKKELSRILRTEAAIKAIEQKANSKKYNNLWPKAVLEALDDAIKENQWE 106 Query: 88 SALKIFDLLRRQQWYEPRCQTYAKMLVML 2 SALKIF+LLR+Q WYEPR +TY K+L+ML Sbjct: 107 SALKIFELLRKQHWYEPRTKTYTKLLMML 135 >gb|PNT19835.1| hypothetical protein POPTR_009G058400v3 [Populus trichocarpa] Length = 484 Score = 134 bits (338), Expect = 9e-35 Identities = 65/89 (73%), Positives = 78/89 (87%) Frame = -2 Query: 268 PQPQSPQFRKFSKKDLSRILRTESAIKAIERKANSSKYNNLLPKAVLEALNDAIKQNRWE 89 P P S ++ SKK+LSRILRTE+AIKAIE+KANS KYNNL PKAVLEAL+DAIK+N+WE Sbjct: 47 PDPTSTGLQRQSKKELSRILRTEAAIKAIEQKANSKKYNNLWPKAVLEALDDAIKENQWE 106 Query: 88 SALKIFDLLRRQQWYEPRCQTYAKMLVML 2 SALKIF+LLR+Q WYEPR +TY K+L+ML Sbjct: 107 SALKIFELLRKQHWYEPRTKTYTKLLMML 135