BLASTX nr result
ID: Rehmannia32_contig00023382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00023382 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN10670.1| hypothetical protein CDL12_16736 [Handroanthus im... 72 3e-12 ref|XP_012847189.1| PREDICTED: uncharacterized protein LOC105967... 66 4e-10 ref|XP_011081734.1| uncharacterized protein LOC105164711 isoform... 65 1e-09 ref|XP_011081733.1| uncharacterized protein LOC105164711 isoform... 65 1e-09 ref|XP_022893926.1| uncharacterized protein LOC111408391 [Olea e... 62 1e-08 ref|XP_022844642.1| uncharacterized protein LOC111367812 [Olea e... 61 2e-08 gb|PIN24722.1| hypothetical protein CDL12_02545 [Handroanthus im... 60 4e-08 ref|XP_009776655.1| PREDICTED: uncharacterized protein LOC104226... 60 4e-08 gb|OVA10081.1| hypothetical protein BVC80_1755g38 [Macleaya cord... 60 7e-08 ref|XP_008382288.1| PREDICTED: uncharacterized protein LOC103445... 59 1e-07 ref|XP_008382268.1| PREDICTED: uncharacterized protein LOC103445... 59 1e-07 ref|XP_008382262.1| PREDICTED: uncharacterized protein LOC103445... 59 1e-07 ref|XP_002269622.2| PREDICTED: uncharacterized protein LOC100247... 59 2e-07 gb|OVA18419.1| hypothetical protein BVC80_1833g85 [Macleaya cord... 59 2e-07 ref|XP_009348928.1| PREDICTED: uncharacterized protein LOC103940... 58 3e-07 ref|XP_009361116.1| PREDICTED: uncharacterized protein LOC103951... 58 3e-07 ref|XP_009348925.1| PREDICTED: uncharacterized protein LOC103940... 58 3e-07 ref|XP_009361112.1| PREDICTED: uncharacterized protein LOC103951... 58 3e-07 ref|XP_009348923.1| PREDICTED: uncharacterized protein LOC103940... 58 3e-07 ref|XP_009361111.1| PREDICTED: uncharacterized protein LOC103951... 58 3e-07 >gb|PIN10670.1| hypothetical protein CDL12_16736 [Handroanthus impetiginosus] Length = 339 Score = 72.0 bits (175), Expect = 3e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -2 Query: 116 MKPRNSEAPRRSQNLQGEGPNWILIAGSALLSTLSIRL 3 MKPR +EAPRRS+NLQGEGPNW+LIAGSALLSTLSIRL Sbjct: 1 MKPRATEAPRRSRNLQGEGPNWVLIAGSALLSTLSIRL 38 >ref|XP_012847189.1| PREDICTED: uncharacterized protein LOC105967153 [Erythranthe guttata] gb|EYU29300.1| hypothetical protein MIMGU_mgv1a009640mg [Erythranthe guttata] Length = 336 Score = 65.9 bits (159), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -2 Query: 116 MKPRNSEAPRRSQNLQGEGPNWILIAGSALLSTLSIRL 3 MKPR +EAPRRS+N QGEG NW+LIAGSALLSTLSIRL Sbjct: 1 MKPRTNEAPRRSRNPQGEGNNWMLIAGSALLSTLSIRL 38 >ref|XP_011081734.1| uncharacterized protein LOC105164711 isoform X2 [Sesamum indicum] ref|XP_011081735.1| uncharacterized protein LOC105164711 isoform X2 [Sesamum indicum] Length = 354 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/49 (69%), Positives = 35/49 (71%) Frame = -2 Query: 149 SFWSLPSIALTMKPRNSEAPRRSQNLQGEGPNWILIAGSALLSTLSIRL 3 S WSL I L MKPR E PR +N Q GPNWILIAG ALLSTLSIRL Sbjct: 4 SIWSLTLITLIMKPRTGEVPR-GRNFQEGGPNWILIAGGALLSTLSIRL 51 >ref|XP_011081733.1| uncharacterized protein LOC105164711 isoform X1 [Sesamum indicum] Length = 364 Score = 64.7 bits (156), Expect = 1e-09 Identities = 34/49 (69%), Positives = 35/49 (71%) Frame = -2 Query: 149 SFWSLPSIALTMKPRNSEAPRRSQNLQGEGPNWILIAGSALLSTLSIRL 3 S WSL I L MKPR E PR +N Q GPNWILIAG ALLSTLSIRL Sbjct: 14 SIWSLTLITLIMKPRTGEVPR-GRNFQEGGPNWILIAGGALLSTLSIRL 61 >ref|XP_022893926.1| uncharacterized protein LOC111408391 [Olea europaea var. sylvestris] ref|XP_022893929.1| uncharacterized protein LOC111408391 [Olea europaea var. sylvestris] ref|XP_022893935.1| uncharacterized protein LOC111408391 [Olea europaea var. sylvestris] Length = 344 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 116 MKPRNSEAPRRSQNLQGEGPNWILIAGSALLSTLSIRL 3 MKPR +E RRS+ LQ EGPNW+LIAGSALLSTL+IRL Sbjct: 5 MKPRTNEVSRRSRGLQEEGPNWVLIAGSALLSTLAIRL 42 >ref|XP_022844642.1| uncharacterized protein LOC111367812 [Olea europaea var. sylvestris] Length = 340 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -2 Query: 116 MKPRNSEAPRRSQNLQGEGPNWILIAGSALLSTLSIRL 3 MK R +E PR S+ LQGEGPNW+LIAG ALLSTLS+RL Sbjct: 1 MKRRTNEVPRSSRGLQGEGPNWVLIAGGALLSTLSVRL 38 >gb|PIN24722.1| hypothetical protein CDL12_02545 [Handroanthus impetiginosus] Length = 268 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = -2 Query: 116 MKPRNSEAPRRSQNLQGEGPNWILIAGSALLSTLSIRL 3 MK R E PRRS+N Q GPNWILIAG ALLSTLSIRL Sbjct: 1 MKTRTGEVPRRSRNFQERGPNWILIAGGALLSTLSIRL 38 >ref|XP_009776655.1| PREDICTED: uncharacterized protein LOC104226377 isoform X1 [Nicotiana sylvestris] Length = 395 Score = 60.5 bits (145), Expect = 4e-08 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = -2 Query: 167 LLVCNISFWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 LLV + + S S+ MKPR + PR RS+ +Q EGPNW++IAGSALLSTLS+RL Sbjct: 34 LLVLHSASPSYSSVTPKMKPRTNVGPRSQRSKGVQNEGPNWVIIAGSALLSTLSVRL 90 >gb|OVA10081.1| hypothetical protein BVC80_1755g38 [Macleaya cordata] Length = 344 Score = 59.7 bits (143), Expect = 7e-08 Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 2/40 (5%) Frame = -2 Query: 116 MKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 MKPR + APR +S+N QG+GPNWILIAG ALLSTLS+RL Sbjct: 1 MKPRTNGAPRAHKSKNFQGQGPNWILIAGGALLSTLSVRL 40 >ref|XP_008382288.1| PREDICTED: uncharacterized protein LOC103445070 isoform X5 [Malus domestica] Length = 287 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QGEGPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLSIRL 55 >ref|XP_008382268.1| PREDICTED: uncharacterized protein LOC103445070 isoform X2 [Malus domestica] Length = 354 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QGEGPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLSIRL 55 >ref|XP_008382262.1| PREDICTED: uncharacterized protein LOC103445070 isoform X1 [Malus domestica] Length = 356 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QGEGPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRVQRSKPFQGEGPNWVLIAGGALLSTLSIRL 55 >ref|XP_002269622.2| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera] ref|XP_010662078.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera] ref|XP_010662079.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera] ref|XP_010662080.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera] ref|XP_010662082.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera] ref|XP_010662083.1| PREDICTED: uncharacterized protein LOC100247776 [Vitis vinifera] emb|CBI26462.3| unnamed protein product, partial [Vitis vinifera] Length = 338 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = -2 Query: 116 MKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 MKPR + PR +S+N QGEGPNW+L+AG ALLSTLSIRL Sbjct: 1 MKPRTNGVPRAQKSRNFQGEGPNWVLLAGGALLSTLSIRL 40 >gb|OVA18419.1| hypothetical protein BVC80_1833g85 [Macleaya cordata] Length = 346 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = -2 Query: 116 MKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 MKPR + APR +S+N QG+GPNWIL AG ALLSTLS+RL Sbjct: 1 MKPRTNGAPRAHKSENFQGQGPNWILFAGGALLSTLSVRL 40 >ref|XP_009348928.1| PREDICTED: uncharacterized protein LOC103940522 isoform X5 [Pyrus x bretschneideri] Length = 287 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QG+GPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLSIRL 55 >ref|XP_009361116.1| PREDICTED: uncharacterized protein LOC103951471 isoform X5 [Pyrus x bretschneideri] Length = 287 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QG+GPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLSIRL 55 >ref|XP_009348925.1| PREDICTED: uncharacterized protein LOC103940522 isoform X2 [Pyrus x bretschneideri] Length = 354 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QG+GPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLSIRL 55 >ref|XP_009361112.1| PREDICTED: uncharacterized protein LOC103951471 isoform X2 [Pyrus x bretschneideri] Length = 354 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QG+GPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLSIRL 55 >ref|XP_009348923.1| PREDICTED: uncharacterized protein LOC103940522 isoform X1 [Pyrus x bretschneideri] Length = 356 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QG+GPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRVQRSKPFQGDGPNWVLIAGGALLSTLSIRL 55 >ref|XP_009361111.1| PREDICTED: uncharacterized protein LOC103951471 isoform X1 [Pyrus x bretschneideri] Length = 356 Score = 57.8 bits (138), Expect = 3e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -2 Query: 146 FWSLPSIALTMKPRNSEAPR--RSQNLQGEGPNWILIAGSALLSTLSIRL 3 F+ +A MKP+ + PR RS+ QG+GPNW+LIAG ALLSTLSIRL Sbjct: 6 FFPPTPLAFKMKPKTTAVPRAQRSKPFQGDGPNWVLIAGGALLSTLSIRL 55